DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5639 and Slpil2

DIOPT Version :9

Sequence 1:	NP_651570.1	Gene:	CG5639 / 43314	FlyBaseID:	FBgn0039527	Length:	1511	Species:	Drosophila melanogaster
Sequence 2:	NP_001008872.1	Gene:	Slpil2 / 408229	RGDID:	1303102	Length:	130	Species:	Rattus norvegicus

Alignment Length:	115	Identity:	33/115 - (28%)
Similarity:	45/115 - (39%)	Gaps:	40/115 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly   777 ACLPRKPGQCPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGCGTQCVDP--------QLK 833
            ||..|||.||.....|            ||.||..|.|.:|||.:.||.:|::|        :..
  Rat    34 ACPARKPVQCLKREKP------------ECSTDWGCPGKQRCCQDTCGFKCLNPVPIPRPVKKKS 86

  Fly   834 TACQHLQAIQLHQSSELGIPARQM-AVAQCDPNNGKWNQVQCSPDGHCWC 882
            .:|           ....:|.|.: .::||. |:|     ||  ||...|
  Rat    87 GSC-----------LRFAVPCRPLPPLSQCQ-NDG-----QC--DGKYKC 117

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5639	NP_651570.1	TY	38..101	CDD:238114
		Lustrin_cystein	180..225	CDD:291299
		TY	286..353	CDD:238114
		Antistasin	373..398	CDD:280912
		WAP	784..830	CDD:278522	15/45 (33%)
		TY	836..903	CDD:238114	12/48 (25%)
		Antistasin	911..936	CDD:280912
		Lustrin_cystein	977..1020	CDD:291299
		TY	1090..1184	CDD:294100
		TY	<1281..1326	CDD:238114
Slpil2	NP_001008872.1	WAP	33..75	CDD:278522	20/52 (38%)
Slpil2	NP_001008872.1	WAP	<96..130	CDD:294103	10/30 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166343521
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1631923at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR19441
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.950