DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and Wfdc5

DIOPT Version :10

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:NP_001100008.1 Gene:Wfdc5 / 296352 RGDID:1304986 Length:123 Species:Rattus norvegicus


Alignment Length:117 Identity:33/117 - (28%)
Similarity:43/117 - (36%) Gaps:35/117 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 DTRCPACQCR-------------DPCEGV---TCGSGKECRVVDVSCEGEYCPPVPACLPR---K 782
            :|:.|...||             .||..|   .|.:.|:| .....|....|  ...|:||   |
  Rat    16 ETQLPVVLCRKKGDKLGGCPPDDGPCSQVIPDQCANDKQC-PSSWKCCSRAC--FLQCMPRVFVK 77

  Fly   783 PGQCPYLVPPGPDNLDANTC----AYECRTDAHCDGARRCCSNGCGTQCVDP 830
            .|:||         :|...|    .:.|..|..|.|.:|||.:.||..|.||
  Rat    78 LGKCP---------VDQLHCLSPRKHLCDKDLDCSGKKRCCVSACGRDCRDP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
WAP 232..281 CDD:459672
TY 286..353 CDD:238114
Antistasin 373..398 CDD:460713
WAP 782..830 CDD:459672 16/51 (31%)
TY 836..903 CDD:238114
Antistasin 911..936 CDD:460713
Thyroglobulin_1 1090..1184 CDD:459665
TY <1281..1326 CDD:238114
Wfdc5NP_001100008.1 WAP 62..120 CDD:469631 20/68 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.