DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and Wfdc12

DIOPT Version :10

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:NP_619625.1 Gene:Wfdc12 / 192200 MGIID:2183434 Length:85 Species:Mus musculus


Alignment Length:47 Identity:16/47 - (34%)
Similarity:23/47 - (48%) Gaps:6/47 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 ICPAPDHSQYTERTGYMCGSPCSHDLECRNMEKCCFTKGCQFNCQQP 281
            :|| ||:.:...:....|.|    |.:|.:.|.|||.: |.|.|..|
Mouse    31 VCP-PDYVRCIRQDDPQCYS----DNDCGDQEICCFWQ-CGFKCVLP 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
WAP 232..281 CDD:459672 15/45 (33%)
TY 286..353 CDD:238114
Antistasin 373..398 CDD:460713
WAP 782..830 CDD:459672
TY 836..903 CDD:238114
Antistasin 911..936 CDD:460713
Thyroglobulin_1 1090..1184 CDD:459665
TY <1281..1326 CDD:238114
Wfdc12NP_619625.1 WAP 31..71 CDD:459672 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.