| Sequence 1: | NP_651570.1 | Gene: | CG5639 / 43314 | FlyBaseID: | FBgn0039527 | Length: | 1511 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_619625.1 | Gene: | Wfdc12 / 192200 | MGIID: | 2183434 | Length: | 85 | Species: | Mus musculus |
| Alignment Length: | 47 | Identity: | 16/47 - (34%) |
|---|---|---|---|
| Similarity: | 23/47 - (48%) | Gaps: | 6/47 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 235 ICPAPDHSQYTERTGYMCGSPCSHDLECRNMEKCCFTKGCQFNCQQP 281 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5639 | NP_651570.1 | TY | 38..101 | CDD:238114 | |
| WAP | 232..281 | CDD:459672 | 15/45 (33%) | ||
| TY | 286..353 | CDD:238114 | |||
| Antistasin | 373..398 | CDD:460713 | |||
| WAP | 782..830 | CDD:459672 | |||
| TY | 836..903 | CDD:238114 | |||
| Antistasin | 911..936 | CDD:460713 | |||
| Thyroglobulin_1 | 1090..1184 | CDD:459665 | |||
| TY | <1281..1326 | CDD:238114 | |||
| Wfdc12 | NP_619625.1 | WAP | 31..71 | CDD:459672 | 15/45 (33%) |
| Blue background indicates that the domain is not in the aligned region. | |||||