powered by:
Protein Alignment CG5639 and Wfdc18
DIOPT Version :9
Sequence 1: | NP_651570.1 |
Gene: | CG5639 / 43314 |
FlyBaseID: | FBgn0039527 |
Length: | 1511 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_598221.2 |
Gene: | Wfdc18 / 171059 |
RGDID: | 619957 |
Length: | 76 |
Species: | Rattus norvegicus |
Alignment Length: | 49 |
Identity: | 20/49 - (40%) |
Similarity: | 23/49 - (46%) |
Gaps: | 5/49 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 782 KPGQCPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGCGTQCVDP 830
|||:||...| ....||...|..|..|...::|||||||..|..|
Rat 31 KPGKCPKNPP-----RSIGTCVELCSGDQSCPNIQKCCSNGCGHVCKSP 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166343528 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.