DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and WFDC3

DIOPT Version :9

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:XP_011526855.1 Gene:WFDC3 / 140686 HGNCID:15957 Length:237 Species:Homo sapiens


Alignment Length:218 Identity:53/218 - (24%)
Similarity:77/218 - (35%) Gaps:59/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 PDNENELVEM-------EVEQCWCVDSFG---TEIPRSRGFN--------------VTDDTCRSL 713
            |.::|...|:       ..||..|....|   .:||:.|..:              :||:||..:
Human    40 PPHKNPCKELCQGDELCPAEQKCCTTGCGRICRDIPKGRKRDCPRVIRKQSCLKRCITDETCPGV 104

  Fly   714 REDLDCLDLTCRMGC----------EYGFSLDPDTRCPA--CQCRDPCEG-VTCGSGKECRVVDV 765
            ::   |..|.|...|          |:|      ..|||  ..|.:.|:| .:|..|.:|  ...
Human   105 KK---CCTLGCNKSCVVPISKQKLAEFG------GECPADPLPCEELCDGDASCPQGHKC--CST 158

  Fly   766 SCEGEYCPPVPACLPRKPGQCPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGCGTQCVDP 830
            .| |..|  :......:.|.||.::        ...|...|..|.:|....:||.:|||..||.|
Human   159 GC-GRTC--LGDIEGGRGGDCPKVL--------VGLCIVGCVMDENCQAGEKCCKSGCGRFCVPP 212

  Fly   831 QLKTACQHLQAIQLHQSSELGIP 853
            .|...........:...|||.||
Human   213 VLPPKLTMNPNWTVRSDSELEIP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
Lustrin_cystein 180..225 CDD:291299
TY 286..353 CDD:238114
Antistasin 373..398 CDD:280912
WAP 784..830 CDD:278522 14/45 (31%)
TY 836..903 CDD:238114 5/18 (28%)
Antistasin 911..936 CDD:280912
Lustrin_cystein 977..1020 CDD:291299
TY 1090..1184 CDD:294100
TY <1281..1326 CDD:238114
WFDC3XP_011526855.1 WAP 37..73 CDD:278522 7/32 (22%)
WAP 81..119 CDD:278522 8/40 (20%)
WAP 130..165 CDD:278522 12/39 (31%)
WAP 174..212 CDD:278522 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19441
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.