DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and Wfdc18

DIOPT Version :10

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:NP_031995.3 Gene:Wfdc18 / 14038 MGIID:107506 Length:74 Species:Mus musculus


Alignment Length:49 Identity:22/49 - (44%)
Similarity:24/49 - (48%) Gaps:5/49 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   782 KPGQCPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGCGTQCVDP 830
            |||.||   .|.|.:.  .||...|..|..|.|..:|||||||..|..|
Mouse    29 KPGACP---KPPPRSF--GTCDERCTGDGSCSGNMKCCSNGCGHACKPP 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
WAP 232..281 CDD:459672
TY 286..353 CDD:238114
Antistasin 373..398 CDD:460713
WAP 782..830 CDD:459672 21/47 (45%)
TY 836..903 CDD:238114
Antistasin 911..936 CDD:460713
Thyroglobulin_1 1090..1184 CDD:459665
TY <1281..1326 CDD:238114
Wfdc18NP_031995.3 WAP 14..73 CDD:238120 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.