| Sequence 1: | NP_651570.1 | Gene: | CG5639 / 43314 | FlyBaseID: | FBgn0039527 | Length: | 1511 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_031995.3 | Gene: | Wfdc18 / 14038 | MGIID: | 107506 | Length: | 74 | Species: | Mus musculus |
| Alignment Length: | 49 | Identity: | 22/49 - (44%) |
|---|---|---|---|
| Similarity: | 24/49 - (48%) | Gaps: | 5/49 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 782 KPGQCPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGCGTQCVDP 830 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5639 | NP_651570.1 | TY | 38..101 | CDD:238114 | |
| WAP | 232..281 | CDD:459672 | |||
| TY | 286..353 | CDD:238114 | |||
| Antistasin | 373..398 | CDD:460713 | |||
| WAP | 782..830 | CDD:459672 | 21/47 (45%) | ||
| TY | 836..903 | CDD:238114 | |||
| Antistasin | 911..936 | CDD:460713 | |||
| Thyroglobulin_1 | 1090..1184 | CDD:459665 | |||
| TY | <1281..1326 | CDD:238114 | |||
| Wfdc18 | NP_031995.3 | WAP | 14..73 | CDD:238120 | 22/49 (45%) |
| Blue background indicates that the domain is not in the aligned region. | |||||