DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and LOC101730330

DIOPT Version :9

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:XP_031758692.1 Gene:LOC101730330 / 101730330 -ID:- Length:235 Species:Xenopus tropicalis


Alignment Length:258 Identity:70/258 - (27%)
Similarity:105/258 - (40%) Gaps:73/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   774 PVPACLPR-KPGQCPYLVPPGPDNLDA--NTCAYECRTDAHCDGARRCCSNGCGTQCVDP--QLK 833
            |.||.:.| |||:|     |.|.|:|:  .:..:||.||..|...|:||.|||..:|:.|  ..:
 Frog    32 PGPAMIGRPKPGKC-----PEPVNIDSCDRSLKHECDTDPQCPANRKCCHNGCRKRCLHPLEDKR 91

  Fly   834 TACQHLQAIQLHQSSELGIPARQMAVAQCDPNNGKWNQVQCSPDGHCWCVDDQGKILPG------ 892
            .:|.:..|    ....|..|:..                :|..||.|          ||      
 Frog    92 DSCPYYDA----SLCGLDFPSDD----------------ECKVDGQC----------PGKERCCC 126

  Fly   893 TRVKSPATPKCQENSSFACPKTNCSLECESGYQMDSNGCPTCECRNYCNEVSCSPHEECQLIS-- 955
            :..:...||...|:..| ||:|..:|.|.|.  :|:   |.|:     .:.||....:|.|..  
 Frog   127 SNCRLECTPTVIEHIGF-CPETIETLSCISA--LDT---PLCQ-----TDSSCPRGWKCCLSGER 180

  Fly   956 VECVDSPCP---KMPICVPRRASICPEGNPLQQGDLDMSCGPHNEHEVCPTTHSCQ---LNPV 1012
            ::||::...   |.||.|.|    ||...|......|.:| |.|: :.|  |.:|:   :.|:
 Frog   181 MQCVEALAEKPGKCPIPVTR----CPPPAPNPACSSDANC-PGNK-KCC--TPACEPKCMEPI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
Lustrin_cystein 180..225 CDD:291299
TY 286..353 CDD:238114
Antistasin 373..398 CDD:280912
WAP 784..830 CDD:278522 18/47 (38%)
TY 836..903 CDD:238114 12/72 (17%)
Antistasin 911..936 CDD:280912 9/24 (38%)
Lustrin_cystein 977..1020 CDD:291299 11/39 (28%)
TY 1090..1184 CDD:294100
TY <1281..1326 CDD:238114
LOC101730330XP_031758692.1 WAP 41..86 CDD:395047 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.