Sequence 1: | NP_651570.1 | Gene: | CG5639 / 43314 | FlyBaseID: | FBgn0039527 | Length: | 1511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031750699.1 | Gene: | LOC100489901 / 100489901 | -ID: | - | Length: | 165 | Species: | Xenopus tropicalis |
Alignment Length: | 208 | Identity: | 50/208 - (24%) |
---|---|---|---|
Similarity: | 69/208 - (33%) | Gaps: | 65/208 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 756 SGKECRVVDVSCEGEYCPPVPACLPRKPGQCPYLVPPGPDNLDAN---TCAYECRTDAHCDGARR 817
Fly 818 CCSNGCGTQCVDP--QLKTACQHLQAIQLHQSSELGIPARQMAVAQCDPNNGKWNQVQCSPDGHC 880
Fly 881 -----WCVDDQGK-ILPGTRVKSPATPKCQENSSFACP---KTNCSLECESGYQMDSNGCPTCE- 935
Fly 936 -CRNYCNEVSCSP 947 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5639 | NP_651570.1 | TY | 38..101 | CDD:238114 | |
Lustrin_cystein | 180..225 | CDD:291299 | |||
TY | 286..353 | CDD:238114 | |||
Antistasin | 373..398 | CDD:280912 | |||
WAP | 784..830 | CDD:278522 | 13/48 (27%) | ||
TY | 836..903 | CDD:238114 | 12/72 (17%) | ||
Antistasin | 911..936 | CDD:280912 | 12/29 (41%) | ||
Lustrin_cystein | 977..1020 | CDD:291299 | |||
TY | 1090..1184 | CDD:294100 | |||
TY | <1281..1326 | CDD:238114 | |||
LOC100489901 | XP_031750699.1 | WAP | 119..164 | CDD:412188 | 18/57 (32%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1631923at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |