DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and LOC100489901

DIOPT Version :9

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:XP_031750699.1 Gene:LOC100489901 / 100489901 -ID:- Length:165 Species:Xenopus tropicalis


Alignment Length:208 Identity:50/208 - (24%)
Similarity:69/208 - (33%) Gaps:65/208 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   756 SGKECRVVDVSCEGEYCPPVPACLPRKPGQCPYLVPPGPDNLDAN---TCAYECRTDAHCDGARR 817
            :|:.|.:..:.|....|...     .|||:||      |:...|.   :....||:|..|.|.::
 Frog     4 TGQICVIGLLLCAVGLCTSA-----AKPGRCP------PEAFLAEKYLSHTNRCRSDGDCGGNKK 57

  Fly   818 CCSNGCGTQCVDP--QLKTACQHLQAIQLHQSSELGIPARQMAVAQCDPNNGKWNQVQCSPDGHC 880
            ||.:.....|..|  :...||                |.......:.|         .|:.|..|
 Frog    58 CCMDNGENFCKPPAHERPGAC----------------PFGTRVPRKTD---------YCTSDSMC 97

  Fly   881 -----WCVDDQGK-ILPGTRVKSPATPKCQENSSFACP---KTNCSLECESGYQMDSNGCPTCE- 935
                 .|..:.|: .||...||..           :||   ..||.:...||.|.||. ||..| 
 Frog    98 PVGSKCCFREGGRTCLPSVGVKKG-----------SCPPGIMINCFVPMRSGCQSDST-CPGNEK 150

  Fly   936 -CRNYCNEVSCSP 947
             ||:.|.. .|.|
 Frog   151 CCRSGCYS-ECKP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
Lustrin_cystein 180..225 CDD:291299
TY 286..353 CDD:238114
Antistasin 373..398 CDD:280912
WAP 784..830 CDD:278522 13/48 (27%)
TY 836..903 CDD:238114 12/72 (17%)
Antistasin 911..936 CDD:280912 12/29 (41%)
Lustrin_cystein 977..1020 CDD:291299
TY 1090..1184 CDD:294100
TY <1281..1326 CDD:238114
LOC100489901XP_031750699.1 WAP 119..164 CDD:412188 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.