DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and LOC100487369

DIOPT Version :9

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:XP_002940798.1 Gene:LOC100487369 / 100487369 -ID:- Length:136 Species:Xenopus tropicalis


Alignment Length:97 Identity:27/97 - (27%)
Similarity:37/97 - (38%) Gaps:18/97 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   749 CEGVTCGSGKECRVVDVSCEGE--------YCPPVPACLPRKPGQCPYLVPPGPDNLDANTCAYE 805
            |..:..||.:|......|.:.|        |||.....     ..||...|.|     :|....|
 Frog    12 CLALAHGSSEESDSTVSSGDSEENYREKRGYCPSNVIL-----DSCPTTCPGG-----SNCSNAE 66

  Fly   806 CRTDAHCDGARRCCSNGCGTQCVDPQLKTACQ 837
            |..|..|...::||:..||..|:||:.|..|:
 Frog    67 CSFDIDCPELQKCCNTNCGMNCIDPEYKPTCE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
Lustrin_cystein 180..225 CDD:291299
TY 286..353 CDD:238114
Antistasin 373..398 CDD:280912
WAP 784..830 CDD:278522 14/45 (31%)
TY 836..903 CDD:238114 1/2 (50%)
Antistasin 911..936 CDD:280912
Lustrin_cystein 977..1020 CDD:291299
TY 1090..1184 CDD:294100
TY <1281..1326 CDD:238114
LOC100487369XP_002940798.1 WAP 53..91 CDD:365870 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.