DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5639 and Wfdc13

DIOPT Version :10

Sequence 1:NP_651570.1 Gene:CG5639 / 43314 FlyBaseID:FBgn0039527 Length:1511 Species:Drosophila melanogaster
Sequence 2:XP_003749678.1 Gene:Wfdc13 / 100365199 RGDID:2319575 Length:81 Species:Rattus norvegicus


Alignment Length:58 Identity:17/58 - (29%)
Similarity:23/58 - (39%) Gaps:2/58 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   776 PACLPRKPGQ--CPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGCGTQCVDPQ 831
            |..:|..|.|  ..|::.|.|...:.:.|...|.....|....:|||..||..|...|
  Rat    17 PQLVPASPKQYFLKYVLEPPPCRSEPDICDTFCTEQEECSPNLQCCSAYCGIVCTSNQ 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5639NP_651570.1 TY 38..101 CDD:238114
WAP 232..281 CDD:459672
TY 286..353 CDD:238114
Antistasin 373..398 CDD:460713
WAP 782..830 CDD:459672 14/49 (29%)
TY 836..903 CDD:238114
Antistasin 911..936 CDD:460713
Thyroglobulin_1 1090..1184 CDD:459665
TY <1281..1326 CDD:238114
Wfdc13XP_003749678.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.