DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp98A and si:ch73-375g18.1

DIOPT Version :9

Sequence 1:NP_524532.2 Gene:Klp98A / 43310 FlyBaseID:FBgn0004387 Length:1265 Species:Drosophila melanogaster
Sequence 2:XP_021325731.1 Gene:si:ch73-375g18.1 / 562945 ZFINID:ZDB-GENE-110408-56 Length:574 Species:Danio rerio


Alignment Length:524 Identity:98/524 - (18%)
Similarity:172/524 - (32%) Gaps:200/524 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 LGRTNIFRFNNPAEAAKLRKDLSRSQLDMSRLSLITSSKENLLTCSIYSDEDGASPYKRPERQYY 609
            :|::::||||:| |.|:|.::.|                    ||   .::.|     .|....|
Zfish     1 MGKSHVFRFNHP-EQARLERERS--------------------TC---VEQQG-----EPADWNY 36

  Fly   610 PQRPMSRDDPELQDENRKILDTIENALKQLNVERVQMHDQYKTKVRKLTEELIRLEQEEMDGLQL 674
            .||.:      |:.:...|...:|..|:.:.:       ||            |.|:||.|    
Zfish    37 AQREL------LEKQGIDIKLEMERRLQDVEI-------QY------------RREKEEAD---- 72

  Fly   675 LNCREQELIARKDMLLWEKNNEKVQIDIVCRQISAFQTQLDSKKRDFSEYVAKELQEL-QDCGKL 738
            |...:|.|.|..|.   ..:::|...:...|.||:.:.:|.:.|          :|.: :.|| |
Zfish    73 LLLEQQRLYADSDS---GDDSDKRSCEESWRLISSLREKLPANK----------VQSIVKRCG-L 123

  Fly   739 DEMGMKIEEGTPLNDELLLQVSDSLDLFAAQFIKDTVRRNNEEIRKLDEQIAEKERILNASTTKI 803
            ...|.:.|   ||.   :.|:..              ||   .|.|..||       |..|..|:
Zfish   124 PSSGKRRE---PLR---VYQIPQ--------------RR---RISKAPEQ-------LTLSDLKL 158

  Fly   804 AKVDETMLEI--------QAQLERLRL-----------------------------------ERA 825
            ..|.|...|:        :.::|.|.:                                   ||:
Zfish   159 QAVKEICYEVALGDFRHSRREVEALAIVKMKELCRMYGRRDAEKDGWREVAEDVWETVGIGDERS 223

  Fly   826 E--SEAESQAMRAKKQNMKLQLGNKSMSTSTSTNEADDVSKSDTYETCDTFHTAQSNLSLVSS-- 886
            :  ::|::::.|:...|:|..: :|.........|.:::...:.....|.....:|.:.:|..  
Zfish   224 QDTADADAESARSGVYNLKAHI-HKLTDILQEVKEQNNMKDEEIKALRDRMMKMESIIPVVQQDD 287

  Fly   887 -------PTITEGQQSPLSNCSCDAEDE---------------------AEDTRKDDLSGSSEET 923
                   |...:|:.......||..::|                     .|..|..:|. ..:.|
Zfish   288 DESEDLPPDGDQGRGLDEDGHSCVPKEERVSRLMEEDPAFRRGRMRWLKQEQMRLQNLQ-QQQIT 351

  Fly   924 SRTCTAGPSSGSGSGSVGIGGSG---------------SAP----SCTPSSQAIMSDSGV-CLDS 968
            .|....|.:.|...|.|.:.|:|               |.|    |..|::..::.:..| |.|.
Zfish   352 KRLRRGGGAVGGDGGVVHLPGTGRFIPPQDCKLKFPFKSNPQHRLSWGPNTSVVVDNLKVDCSDG 416

  Fly   969 RNQA 972
            |:.|
Zfish   417 RSPA 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp98ANP_524532.2 KISc_KIF1A_KIF1B 2..371 CDD:276816
KISc 3..371 CDD:214526
Kinesin_assoc 370..478 CDD:292801
FHA 456..555 CDD:238017 4/9 (44%)
PX_KIF16B_SNX23 1131..1259 CDD:132784
si:ch73-375g18.1XP_021325731.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D76316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.