DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp98A and ncd

DIOPT Version :9

Sequence 1:NP_524532.2 Gene:Klp98A / 43310 FlyBaseID:FBgn0004387 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster


Alignment Length:393 Identity:127/393 - (32%)
Similarity:196/393 - (49%) Gaps:71/393 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLKVAVRVRPFNSREIDMDAQLIMEMENKKTRLL---------KPRLQSIRDAGRDNHHDFTFDY 58
            :::|..|:||              .:|:::.|:.         ...||||     |.........
  Fly   348 NIRVFCRIRP--------------PLESEENRMCCTWTYHDESTVELQSI-----DAQAKSKMGQ 393

  Fly    59 SYWSFDAEDPHFATQEQVYSDLGNDVVDCAYEGYNACVFAYGQTGSGKTFTMMGTPNNPGLIPRI 123
            ..:|||......::|..:: ::.:.::..|.:|||.|:|||||||||||:||.|.|.:.|:|||.
  Fly   394 QIFSFDQVFHPLSSQSDIF-EMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRT 457

  Fly   124 CEELFARMRVGQESGTGYRTHASYLEIYNERVKDLLAAQSTGHGLRVREHRSLGPYVENLSQHAV 188
            .:.||..:|..:..|..|...|::||||||.:.|||:.:.....:|:.::.....||.|:::..|
  Fly   458 VDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETV 522

  Fly   189 SDFDEIQECIARGNAQRTTASTNMNDTSSRSHAIFTITFVQAVFMNDMPSE-TVSKIHLVDLAGS 252
            .|.:.::..:......|.||||..|:.||||||   :|.::.:..:....| :|..|:|||||||
  Fly   523 LDPNHLRHLMHTAKMNRATASTAGNERSSRSHA---VTKLELIGRHAEKQEISVGSINLVDLAGS 584

  Fly   253 ERANATGATGQRLKEGAHINKSLVTLGSVISALAEQTGGGHNSSSSALATTPNGASKRVLYIPYR 317
            |    :..|..|:.|..:||:||..|.:||.||.::..                      :||||
  Fly   585 E----SPKTSTRMTETKNINRSLSELTNVILALLQKQD----------------------HIPYR 623

  Fly   318 DSILTWLLKDSLGGNSKTIMIAALSP-ADCNYSETLSTLRYA--------NRAK--NIINKPTVN 371
            :|.||.||..||||||||:|...:|| .|| :.|::.:||:|        .:||  ..:|....|
  Fly   624 NSKLTHLLMPSLGGNSKTLMFINVSPFQDC-FQESVKSLRFAASVNSCKMTKAKRNRYLNNSVAN 687

  Fly   372 EDT 374
            ..|
  Fly   688 SST 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp98ANP_524532.2 KISc_KIF1A_KIF1B 2..371 CDD:276816 125/388 (32%)
KISc 3..371 CDD:214526 125/388 (32%)
Kinesin_assoc 370..478 CDD:292801 2/5 (40%)
FHA 456..555 CDD:238017
PX_KIF16B_SNX23 1131..1259 CDD:132784
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 122/373 (33%)
KISc 348..678 CDD:214526 124/379 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437731
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.