DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr68a

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:340 Identity:68/340 - (20%)
Similarity:130/340 - (38%) Gaps:68/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DSSKVMGNTQKVLVVAMFVWNQLNILLNFRRLARIYDDIADLEIDLNNASSGFVGQRHWWRFRFR 144
            |:.::....:.:|.:..:....|:.:.|..|..|...|||  :||....::||   |..:..|. 
  Fly    75 DTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIA--KIDEYLLANGF---RETYSCRN- 133

  Fly   145 LALSVGLWIVLLVGLTPRFTLVALGPYLHWTNKV--LTEIILIMLQLKCTEYCVFVLLIYE--LI 205
                    :.:||.......|.....|:|:.:.:  ..:|||:::        .|:.|:|.  |.
  Fly   134 --------LTILVTSAAGGVLAVAFYYIHYRSGIGAKRQIILLLI--------YFLQLLYSTLLA 182

  Fly   206 LRGRHILQQISVELEG--NQSRDS--------------VQELCVALKRNQLLAGRIWGLVNEVSL 254
            |..|.::..::..: |  ||..|:              :..|...|.:.:.:...| ..|..|||
  Fly   183 LYLRTLMMNLAQRI-GFLNQKLDTFNLQDCGHMENWRELSNLIEVLCKFRYITENI-NCVAGVSL 245

  Fly   255 YFTLSLTLLFLYNE--LTILQIVNWALIKSVNPNECCQYRRVG-TCLLL---SINIFLSCLYSEF 313
            .|....:...:.|:  |....:...:|.......:     .:| :|:.:   :|.:.:.|...:.
  Fly   246 LFYFGFSFYTVTNQSYLAFATLTAGSLSSKTEVAD-----TIGLSCIWVLAETITMIVICSACDG 305

  Fly   314 CIQTYNSISRVLHQMYCLSAAEDYLILKMGLREYSLQMEHLKLIFTCGGLFDIN----LKFFGGM 374
            .....|..:::|.::|..|.....||.|...:.....::     ||..|.|.|:    .|.|..:
  Fly   306 LASEVNGTAQILARIYGKSKQFQNLIDKFLTKSIKQDLQ-----FTAYGFFSIDNSTLFKIFSAV 365

  Fly   375 VVTLFGYIIILVQFK 389
            ..    |::||:|||
  Fly   366 TT----YLVILIQFK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 68/340 (20%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 68/340 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.