DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr43a

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:501 Identity:98/501 - (19%)
Similarity:163/501 - (32%) Gaps:182/501 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SRLLAAARPYIQIYSIFGLTPPIQFFTRTLHKRRRGIVILG----YACYLISISLMVIYECYANI 66
            |::||.| ||..:                  :..:|.|.:|    :..|..::::::::..|..:
  Fly    14 SKVLALA-PYATV------------------RNSKGRVEIGRSWLFTVYSATLTVVMVFLTYRGL 59

  Fly    67 VALQKDIHKFHAED------SSKVMGNTQKVL------VVAMFVW-------------------- 99
            :        |.|..      |.::...|.||:      ||.|.:.                    
  Fly    60 L--------FDANSEIPVRASFRMKSATSKVVTALDVSVVVMAIVSGVYCGLFSLNDTLELNDRL 116

  Fly   100 ----NQLNILLNFRR-------LARI----YDDIADLEI--------DLNNASSGFVGQRHWWRF 141
                |.||...||||       :|.:    ...:..|::        |:|.|.|......||:..
  Fly   117 NKIDNTLNAYNNFRRDRWRALGMAAVSLLAISILVGLDVGTWMRIAQDMNIAQSDTELNVHWYIP 181

  Fly   142 RFRLALSVGLWIVLLVGLTPRF--TLVALGPYLHWTNKVLTEIIL--------IMLQLKCTEYCV 196
            .:.|       ..:|.||....  |...||......|::|:...|        |..|...|...|
  Fly   182 FYSL-------YFILTGLQVNIANTAYGLGRRFGRLNRMLSSSFLAENNATSAIKPQKVSTVKNV 239

  Fly   197 FV-----------------------------------LLIYELILRGRHILQQISVELEGNQSRD 226
            .|                                   :|..||:..|....:...:.|:  ...|
  Fly   240 SVNRPAMPSALHASLTKLNGETLPSEAAGDKAAARSLILNVELLKLGYFPAKNKGLLLK--SLAD 302

  Fly   227 SVQEL--CVALKRNQLLAGRIWGLVNEVSLYFTLSLTLLFLYNELTI--------LQIVNWALIK 281
            |.:.|  ||.|..|......::.|   ||....|..|..||:.||..        :|:: |.   
  Fly   303 SHESLGKCVHLLSNSFGIAVLFIL---VSCLLHLVATAYFLFLELLSKRDNGYLWVQML-WI--- 360

  Fly   282 SVNPNECCQYRRVGTCLLLSINIFLSCLYSEFCIQTYNSISRVLHQMYCLSAAEDYLILKMGLRE 346
                  |..:.|:   |::.....|:...|...||....|.|.:|:.          ||...:::
  Fly   361 ------CFHFLRL---LMVVEPCHLAARESRKTIQIVCEIERKVHEP----------ILAEAVKK 406

  Fly   347 YSLQMEHLKLIFTCGGLFDIN---LKFFGGMVVTLFGYIIILVQFK 389
            :..|:..:...|:..||..:|   |..|...:.|   |::||:||:
  Fly   407 FWQQLLVVDADFSACGLCRVNRTILTSFASAIAT---YLVILIQFQ 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 94/494 (19%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 97/499 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.