DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr9a

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:368 Identity:69/368 - (18%)
Similarity:133/368 - (36%) Gaps:92/368 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LISISLMVIYECYANIVALQKDIHKFHAE---DSSKVMGNTQKVLV------VAMFVWNQLNILL 106
            |:|.:.:|:.     ::.|..:|..:..|   |:..|.....||::      ..:..|..|:.|.
  Fly    30 LLSSTFLVLI-----LIELVGEIETYFTEENPDNESVPAYFAKVIMGVNMAYKMIHAWIALSALF 89

  Fly   107 NFRRLARIYDDIADLEIDLNNASSGFVGQRHWWRFRFRLALSVGLWIVLLVGLTPRFTLVALGPY 171
            ..||...:.:::..::      ::.|: .||       |.|.:              .|.|...:
  Fly    90 ECRRFRYLLEELPPVK------ATSFI-YRH-------LILEI--------------ILFACNAF 126

  Fly   172 LHWTNKVLTEIILIMLQLKCTEYCVFVLLIYEL-ILRGRHILQQISVE-LEG--NQSRDSVQELC 232
            |     ||:|..:..:.|:...|.      |.| .:|.|::...:.|: |:|  .|....|....
  Fly   127 L-----VLSEYTIRGIYLENLRYA------YSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGS 180

  Fly   233 VALKRNQLLAGRIWGLVNEVSLYFTLSLTLLFLYNELTILQIVNWALIKSVNPNECCQYRRVGTC 297
            ...|..:|....:..:...:|..|.|||.|      |.:|.:.:|.::       |..|..|...
  Fly   181 SDYKTLRLDYAHLAKVTRSLSHLFGLSLLL------LNVLCLGDWIIV-------CNVYFMVAYL 232

  Fly   298 LLLSINIFL-----------------SCLYSEFCIQTYNSISRVLHQMYCLSAAEDYLILKMGLR 345
            .:|...:||                 .|..|..|:.....:.:.|..:...:..|     :..:.
  Fly   233 QVLPATLFLFGQVMFVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVE-----RSQIE 292

  Fly   346 EYSLQMEHLKLIFTCGGLFDINLKFFGGMVVTLFGYIIILVQF 388
            .::||:....:.....|::.:||:...||...:...::|.:||
  Fly   293 GFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 69/368 (19%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 67/366 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.