DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr2a

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster


Alignment Length:434 Identity:84/434 - (19%)
Similarity:167/434 - (38%) Gaps:121/434 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAAARPYIQIYSIFGLTPPIQFFTRTLHKRRRG---IVILGYACYLISISLMVIYECYANIVAL 69
            |:||..     ::::||     |...::.:::..   |..:|:....|.:..|.:....|.:.||
  Fly    49 LIAATS-----FTVYGL-----FQESSVEEKQDSESTISSIGHTVDFIQLVGMRVAHLAALLEAL 103

  Fly    70 -QKDIHK-FHAEDSSKVMGNTQKVLVVAMFVWNQLNILLNFRRLARIYDDIADLEIDLNNASSGF 132
             |:...: |.||     :|...::|..|:.|                  |:..:.|::...:|  
  Fly   104 WQRQAQRGFFAE-----LGEIDRLLSKALRV------------------DVEAMRINMRRQTS-- 143

  Fly   133 VGQRHW--WRFRFRLALSVGLWIVLLVGLTPRFTLVALGPYLHWTNKVLTEIIL------IMLQL 189
             .:..|  |.:.....|.:|   ..|:....||.       ::|.:.:|..::.      |....
  Fly   144 -RRAVWILWGYAVSQLLILG---AKLLSRGDRFP-------IYWISYLLPLLVCGLRYFQIFNAT 197

  Fly   190 KCTEYCVFVLLIYELILRGRHILQQISVELEGN------QSRDSVQELCV-ALKRNQLLAGRIWG 247
            :.....:.|||:         .|||:.:..:|.      :.::.::|..: .|...:|:..|:|.
  Fly   198 QLVRQRLDVLLV---------ALQQLQLHQKGPAVDTVLEEQEDLEEAAMDRLIAVRLVYQRVWA 253

  Fly   248 LVNEVSLYFTLSLTLLFLYNELTILQIVNWALI----KSVNPNECCQY--------RRVGTCLLL 300
            ||..::..:.||:.:....:.|.|.....|..:    .:.:|.:..|.        ..:|..|:|
  Fly   254 LVALLNRCYGLSMLMQVGNDFLAITSNCYWMFLNFRQSAASPFDILQIVASGVWSAPHLGNVLVL 318

  Fly   301 SINIFLSCLYSEFCIQTYNSISRV---LHQM------------------YCLSAAEDYLILKMGL 344
            |:          .|.:|....||:   |||:                  ||   |...:::.:.:
  Fly   319 SL----------LCDRTAQCASRLALCLHQVSVDLRNESHNALVGTLVRYC---APLIILVPLQI 370

  Fly   345 REYSLQMEHLKLIFTCGGLFDINLKFFGGMVVTLFGYIIILVQF 388
            .::|||:.|.:|.|:..|.|:::......:|.....|:|||:||
  Fly   371 TQFSLQLLHQRLHFSAAGFFNVDCTLLYTIVGATTTYLIILIQF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 81/429 (19%)
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 84/434 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.