DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and lite-1

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:358 Identity:69/358 - (19%)
Similarity:122/358 - (34%) Gaps:145/358 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 VGQRHWWRFRFRLALSVGLWIVLLVGLTPRFTLVALGPYLHWTNKVLTEIILIMLQLKCTEYCVF 197
            :..|:.|....|....: .:::|::||..     ::.|    .|.:|..|.         .:.||
 Worm    35 LSSRNKWAICDRTLYPI-YYLLLILGLNQ-----SIRP----NNSLLFRIY---------SWLVF 80

  Fly   198 VLLIYELILRGRHILQQISVELEGNQSRDSVQE----------LCVALKRNQLLAGRIWGLVNEV 252
            .||::..:.:    ..|:.|...|  :|:::||          ||.||.       .:.||:..:
 Worm    81 CLLLFTTLRK----FNQVGVRPNG--TRENLQEFFANPRSMITLCNALI-------MLSGLLASL 132

  Fly   253 SLY---------------FTLSL-------------TLLFLYNELTILQIV------NWALIKSV 283
            .||               |:|::             |.|.:::.|..|.:.      .|..|..:
 Worm   133 QLYTLGAKRLKPLKILCQFSLNVRTKQAERRQFMINTFLAVFSGLLALTMAATYAMSKWGYILYI 197

  Fly   284 NPNECCQYRRVGT---------CLLL-SINIF--------LSCLYSEFCIQTYNSISRVLHQMYC 330
                      |||         |:|| |..:|        |:.|:.:.|.....||..::::|  
 Worm   198 ----------VGTPNLDTETIFCVLLDSYALFVSRAAISALAILFYQHCSVIRRSIKHLINEM-- 250

  Fly   331 LSAAEDYLILKMGLREYSLQMEH---------------------LKLIFTCGGLFDI--NLKFFG 372
            :.|.:|    :..|.|.|||..|                     ..|.::.|....|  .|.|.|
 Worm   251 VPAEQD----ECPLPESSLQKIHDCQISYQRIFNGKAVIEEYYSFVLFYSYGVCIPIFCFLMFVG 311

  Fly   373 ------------GMVVTLFGYIIILVQFKIQFF 393
                        .:|:.:...|::|:.|.:..|
 Worm   312 MSAQSICWSEVVSIVIWIVNAILVLLLFSLPAF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 68/355 (19%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 59/308 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.