DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr22a

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster


Alignment Length:406 Identity:87/406 - (21%)
Similarity:164/406 - (40%) Gaps:87/406 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IFGLTPPIQFFTRTLHKRR--RGIVILGYACYLISISLMVIYECYANIVALQKDIH---KFHAED 80
            :.||.|    ||....|||  |...:|.|. .:::::|:|:      .:....|.|   |.....
  Fly    28 VLGLFP----FTFDSRKRRLNRSKWLLAYG-LVLNLTLLVL------SMLPSTDDHNSVKVEVFQ 81

  Fly    81 SSKVMGNTQKVLVVAMFVWNQLNILLNFRRLARIYDDIAD-LEIDLNNASSGFVGQRHWWRFRFR 144
            .:.::...::::.|...:...:..|..|.|.:.:.:.:.: |.:|.|:.|...:.:.|.:.   |
  Fly    82 RNPLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILNELLVLDKNHFSKLMLSECHTFN---R 143

  Fly   145 LALSVGLWIVLLVGLT-------PRFTLV---ALGPYLHWTNKVLTEIILIMLQLKCTEYCVFVL 199
            ..:..||.|:|.:|.:       |...:|   |:..|:     |..|::::::     .:.:.|:
  Fly   144 YVIEKGLVIILEIGSSLVLYFGIPNSKIVVYEAVCIYI-----VQLEVLMVVM-----HFHLAVI 198

  Fly   200 LIYEL--ILRGRHILQQISVELEGNQSRDSVQELCVALKRNQLLA---GRIWGLVNEVSLYFTLS 259
            .||..  |:.|: :|...|....|    |||..     .|.|||.   .|:..|.:.::..:.:.
  Fly   199 YIYRYLWIINGQ-LLDMASRLRRG----DSVDP-----DRIQLLLWLYSRLLDLNHRLTAIYDIQ 253

  Fly   260 LTLLFLYNELTILQIVNWALIKSVNPNECCQYRRVGTCLLLSINIFLSCLYSEFCIQTYNSISRV 324
            :| ||:....::..||...|:       .|........||:...:|...|...|. ..:..|:  
  Fly   254 VT-LFMATLFSVNIIVGHVLV-------ICWINITRFSLLVIFLLFPQALIINFW-DLWQGIA-- 307

  Fly   325 LHQMYC----LSAAEDYLILKM-------------GLREYSLQMEHLKLIFTCGGLFDINLKFFG 372
                :|    .:..:..:|||:             .:.|::|...|.:|.....||.|||.:...
  Fly   308 ----FCDLAESTGKKTSMILKLFNDMENMDQETERRVTEFTLFCSHRRLKVCHLGLLDINYEMGF 368

  Fly   373 GMVVTLFGYIIILVQF 388
            .|::|...|::.||||
  Fly   369 RMIITNILYVVFLVQF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 87/406 (21%)
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 87/406 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.