DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr36a

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:342 Identity:68/342 - (19%)
Similarity:130/342 - (38%) Gaps:93/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VLVVAMFVWNQLNILLNFRRLARIYDDIADLEIDLNNASSGFVGQRHWWRFR---------FRLA 146
            :|:..::.:.|:..|:||             |||             |.|.|         |.:|
  Fly     7 LLLKVLYYYGQIIGLINF-------------EID-------------WQRGRVVAAQRGILFAIA 45

  Fly   147 LSVGLWIVLLVGLTPRFTLVALGPYLHWTNKVLTEIILIMLQLKCTEYCVFVL------------ 199
            ::|.:.:|||:.::.:|.   |..|....|::...:|::|:.|:.......:|            
  Fly    46 INVLICMVLLLQISKKFN---LDVYFGRANQLHQYVIIVMVSLRMASGISAILNRWRQRAQLMRL 107

  Fly   200 --LIYELILRGRH--------ILQQISVELEGN--QSRDSVQELCVALKRNQL--LAGRIW--GL 248
              .:..|.|:..|        ||.:.||.:..|  |...|::.| ..|..|:.  :|...|  .:
  Fly   108 VECVLRLFLKKPHVKQMSRWAILVKFSVGVVSNFLQMAISMESL-DRLGFNEFVGMASDFWMSAI 171

  Fly   249 VN-EVSLYFTLSLTLLFLYNEL--TILQIVNWA-LIKSVNP------NECCQYR-RVGTCLLL-- 300
            :| .:|.::.:.|.:...|:.|  .:.|.::.: ::..:.|      .:||... |:.....|  
  Fly   172 INMAISQHYLVILFVRAYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQN 236

  Fly   301 SINIFLSCLYSEFCIQTYNSISRVLHQMYCLSAAEDYLILKM---GLREYSLQMEHLKLIFTCGG 362
            .:...::.|...|.||..    .|....|..|.|..|:...:   |:.|..|.:....|:|:.  
  Fly   237 QLQSIVTQLNQVFGIQGI----MVYGGYYIFSVATTYITYSLAINGIEELHLSVRAAALVFSW-- 295

  Fly   363 LFDINLKFFGGMVVTLF 379
                .|.::...::.||
  Fly   296 ----FLFYYTSAILNLF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 68/342 (20%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 67/340 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.