DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr36b

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:410 Identity:76/410 - (18%)
Similarity:155/410 - (37%) Gaps:99/410 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CYLISIS---------------LMVIYECYANIVALQKDIHKFHAE-DSSKVMGNTQKVLVVAMF 97
            ||||.:|               ...||...|||..|...|:.|.|. |::.:..:..|:....:.
  Fly    16 CYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLFQSANKLHEYVII 80

  Fly    98 VWNQLNIL----------LNFRRLARIYDDIADLEIDLNNASSGFVGQRHWWRFRFRLALSVG-- 150
            :.:.|.|:          |...::.::..|:..|.: :|......:.    |....:..:|..  
  Fly    81 IMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRLYM-INPQLKSMIR----WGILLKAFISFAIE 140

  Fly   151 -LWIVLLV-GLTPRFTLVALGPYLHWTNKVLTEI-ILIMLQLKCTEYCVFVLLIYELILRGRHIL 212
             |.:.|.| .|..:.|...:|        :|.:: :..::.|..:::.:.:|||     |.::.:
  Fly   141 LLQVTLSVDALDRQGTAEMMG--------LLVKLCVSFIMNLAISQHFLVILLI-----RAQYRI 192

  Fly   213 QQISVELEGNQSR--------------------DSVQELCVALKRNQLLAGRIWGLVNEVSLYFT 257
            ....:.:...:||                    |.::::.....:.|.:.|::    :||     
  Fly   193 MNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQL----DEV----- 248

  Fly   258 LSLTLLFLYNE--LTIL--QIVNWALIKSVNPN-ECCQYRRVGTCLLLSINIFLSCLYSEFCIQT 317
            ..:..|..|:|  |:|:  ..:::::.|....| :......:..|:|::: .:|..|.:  |   
  Fly   249 FGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITL-FYLDALVN--C--- 307

  Fly   318 YNSISRVL-HQMYCLSAAEDYLI--------LKMGLREYSLQMEHLKLIFTCGGLFDINLKFFGG 373
             |::.||| |....|...|:..:        |:.......||:....|.....|:|.|.......
  Fly   308 -NNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAA 371

  Fly   374 MVVTLFGYIIILVQFKIQFF 393
            |..::....|.|:||.::||
  Fly   372 MCASVIVNSIFLIQFDMEFF 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 74/407 (18%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 74/407 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.