DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr59a

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:364 Identity:74/364 - (20%)
Similarity:129/364 - (35%) Gaps:109/364 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RRLARIYDDIADLEIDLNNASSGFVGQRHWWRF--RFRLALSVGLWIVLLVGLTPRFTLVALGPY 171
            :|:.:.|           |..:.|:|...:...  :||.:....::.:|:..:     .:.|.|.
  Fly     2 KRIGQAY-----------NVYAVFIGMTSYETMGGKFRQSRITRIYCLLINAI-----FLTLLPS 50

  Fly   172 LHWTN-KVLTEIILIMLQLKCTEYCV----FVLLIYELI---LRGRHILQQISVELEGNQSRDSV 228
            ..|.: |:|:....:...::.|.|.:    :..:.|.||   .|...::....:.||.|:     
  Fly    51 AFWKSAKLLSTADWMPSYMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQRIVLEVNR----- 110

  Fly   229 QELCVALKRNQLLAGRIWGLVNEVSLYFTLSLTL-LFLYNELTILQIVNWALIKSVNPNECCQYR 292
            :.|....|.|.||. |::.|......|..||..| :|:|.    .:..||:              
  Fly   111 EMLRTGKKMNSLLR-RMFFLKTFTLTYSCLSYILAVFIYQ----WKAQNWS-------------- 156

  Fly   293 RVGTCLLLSINIFLSCLY----------------SEFCIQTYNSI-----------SRVLHQMYC 330
              ..|..|.:||.|:.|:                .:|..|..|.|           |:.|..::.
  Fly   157 --NLCNGLLVNISLTILFVNTFFYFTSLWHIARGYDFVNQQLNEIVACQSMDLERKSKELRGLWA 219

  Fly   331 LSAAEDYLILKMGLREYSLQMEHLK-------LIFTC-GGLFDIN------LKFFGGMV------ 375
            |.....|...::. :.|..||..::       :|..| |.::...      .|.||.::      
  Fly   220 LHRNLSYTARRIN-KHYGPQMLAMRFDYFIFSIINACIGTIYSTTDQEPSLEKIFGSLIYWVRSF 283

  Fly   376 -VTLFGYIIILV---QFKIQFFAQSNFMQNINSTELKAY 410
             ..|..||..||   |.:.:|||..:.|.|    ||.:|
  Fly   284 DFFLNDYICDLVSEYQMQPKFFAPESSMSN----ELSSY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 66/344 (19%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 73/359 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.