DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr59b

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:392 Identity:73/392 - (18%)
Similarity:127/392 - (32%) Gaps:171/392 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 WWRFR--FRLALSVGL-----------------WIVLLVGLTPRFTLVALGPYLHW-------TN 176
            :|..:  ||.:|::|:                 ...|:..:.   ||:.| |.:.|       ..
  Fly     3 YWMIKLYFRYSLAIGITSQQFSNRKFFSTLFSRTYALIANIV---TLIML-PIVMWQVQLVFQQK 63

  Fly   177 KVLTEIILIMLQLKCTEYCVFVLLIYELILRGRHILQQISVELEGNQSRDS----VQELCVALKR 237
            |...::|||...::  |...|::::|.::.||               .||:    :|.|.:.|.|
  Fly    64 KTFPKLILITNNVR--EAVSFLVILYTVLSRG---------------FRDTAFKEMQPLLLTLFR 111

  Fly   238 NQLLAG--RIWGLVNEVSL-----YFTLS----------------------LTLLFLYNELTILQ 273
            .:...|  .|.|:...:.:     :||||                      |...|..|...||:
  Fly   112 EEKRCGFKGIGGVRRSLRILLFVKFFTLSWLCVTDVLFLLYSTDALIWVNVLRFFFKCNTNNILE 176

  Fly   274 IVN-------WALIKSVNPNECCQYRRVG---------------------TCL---LLSIN---- 303
            :|.       |.:.:..:    |..||:.                     .||   .|:||    
  Fly   177 MVPMGYFLALWHIARGFD----CVNRRLDQIVKSKSTRKHRELQHLWLLHACLTKTALNINKIYA 237

  Fly   304 ----------------------IFLSCLYSEFCIQTYNSISRVLHQMYCLSAAEDYLILKM---- 342
                                  :|...|.:.|....|.|:.   :.:.||   :.|||..|    
  Fly   238 PQMLASRFDNFVNGVIQAYWGAVFTFDLSTPFFWVVYGSVQ---YHVRCL---DYYLIDNMCDVA 296

  Fly   343 ------------------GLREYSLQMEHLKL-IFTCGGLFDINLKFFGGMVVTLFGYIIILVQF 388
                              .:..|.:.....|| :::| |||..|...:..|:.::..||::|:||
  Fly   297 VEYHDSAKHSWSEVRWTKEISSYVIYANSTKLQLWSC-GLFQANRSMWFAMISSVLYYILVLLQF 360

  Fly   389 KI 390
            .:
  Fly   361 HL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 73/392 (19%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 72/389 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.