DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98d and Gr93b

DIOPT Version :9

Sequence 1:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster


Alignment Length:246 Identity:44/246 - (17%)
Similarity:103/246 - (41%) Gaps:66/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GIVILGYACYLISISLMVIYECYANIV--ALQKDIHKFHAEDSS---------KVMGNTQKVLVV 94
            |..::.:.|::..:|:.|:|....|.|  .|:..:...:.|::|         :.:.|..|.|  
  Fly   185 GTGMITHLCFVGYLSIGVLYRDLNNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCL-- 247

  Fly    95 AMFVWNQLNILLNFRRLARIYDDIADLEIDLNNASSGFVGQRHWWRFRFRLALSVGLWIVLLVGL 159
              :::::::      :::|.:..:.||.:.|:.|.|........:....|...|..||.:::   
  Fly   248 --YLYDEIH------QVSRSFQQLFDLPLFLSLAQSLLAMSMVSYHAILRRQYSFNLWGLVI--- 301

  Fly   160 TPRFTLVALGPYLHWTNKVLTEIILIMLQLKCTEYCVFVLLIYELILRGRHILQQISVE---LEG 221
                             |:|.:::|:.:.:...             :.|..:::::|.|   :..
  Fly   302 -----------------KLLIDVVLLTMSVHSA-------------VNGSRLIRRLSFENFYVTD 336

  Fly   222 NQSRDSVQELCVALKRNQLLAGRIWGL-----VNEVSLYFTLSLT--LLFL 265
            :||.....||.:...::|.|  |::.|     .||::|:|..::.  |:||
  Fly   337 SQSYHQKLELFLGRLQHQEL--RVFPLGLFEVSNELTLFFLSAMVTYLVFL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 44/246 (18%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 44/246 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.