DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr68a

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:271 Identity:60/271 - (22%)
Similarity:104/271 - (38%) Gaps:72/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IIRWLIFIVVTIYSN------RALTINATYSELVFL-ARFSEFTLYCAVILFIYQELIVGGSNVL 194
            ||..||:.:..:||.      |.|.:|.. ..:.|| .:...|.|.....:..::||    ||::
  Fly   165 IILLLIYFLQLLYSTLLALYLRTLMMNLA-QRIGFLNQKLDTFNLQDCGHMENWREL----SNLI 224

  Fly   195 DELYRTRYEMWSIRRLSLQKLAKLQAIHNSLWQAIRC-----LECYFQLSLITLLMKFFIDTSAL 254
            :.|.:.||                      :.:.|.|     |..||..|..|:..:.::..:.|
  Fly   225 EVLCKFRY----------------------ITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATL 267

  Fly   255 PYWLYLSRVEHTRVAVQHYVAT---VECIKLL-EIVVPCYLCTRCDAM------QRKFLSMFYTV 309
            ......|:.|         ||.   :.||.:| |.:....:|:.||.:      ..:.|:..|  
  Fly   268 TAGSLSSKTE---------VADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQILARIY-- 321

  Fly   310 TTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQFSINFRAKK 374
               .:|.|....:.....:..::..:|:|.|...|:...|.|.|..:.:|:||.|||      |:
  Fly   322 ---GKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF------KQ 377

  Fly   375 MSN---EQMSQ 382
            :.:   |.:||
  Fly   378 LEDSKVEDISQ 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 56/254 (22%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 57/260 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.