DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr63a

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:417 Identity:88/417 - (21%)
Similarity:157/417 - (37%) Gaps:104/417 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MKCLGMLP----------FGQNLFSKGFCY-VLLFVSLG-FSSYWRFSFDYEFDYDFLNDRFSST 72
            ::.:|:||          |..|  |..|.| |:.||.|. :..|            ..|:|....
  Fly    84 LRIIGVLPIVRHGPARAKFEMN--SASFIYSVVFFVLLACYVGY------------VANNRIHIV 134

  Fly    73 IDLSN-FVALVLGH-------AIIVLELLWGNCSK------DVDRQLQAIHSQI---KLQLGTSN 120
            ..||. |...|:.:       .|:::.:||....|      |.| ..:.::.||   .|.|    
  Fly   135 RSLSGPFEEAVIAYLFLVNILPIMIIPILWYEARKIAKLFNDWD-DFEVLYYQISGHSLPL---- 194

  Fly   121 STDRVRRYCNWIYGSLIIRWLIFIVVTIYSNRALTINATYSELVFLARFSEFTLYC-----AVIL 180
               ::|:...:|...|.|..::.:|:|         :.|.|:|    ..::...||     ..:|
  Fly   195 ---KLRQKAVYIAIVLPILSVLSVVIT---------HVTMSDL----NINQVVPYCILDNLTAML 243

  Fly   181 FIYQELIVGGSNVLDELYRTRYEMWSIRRLSLQKL--AKLQAIHNSLWQAIRCLE-------CYF 236
            ..:..||....::...|...|::.      :|:.:  |.:.|.:..||..:..|.       || 
  Fly   244 GAWWFLICEAMSITAHLLAERFQK------ALKHIGPAAMVADYRVLWLRLSKLTRDTGNALCY- 301

  Fly   237 QLSLITLLMKFFIDTSALPYWLYLSRVEHTRVAVQHYVATVECIKLLEIVVPCYLCTRC------ 295
             ..:...|..|||.|.:: |.| :|::.. ...::....|:..  |..|.:..|:|...      
  Fly   302 -TFVFMSLYLFFIITLSI-YGL-MSQLSE-GFGIKDIGLTITA--LWNIGLLFYICDEAHYASVN 360

  Fly   296 --DAMQRKFLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMIS 358
              ...|:|.|.:..........:::|..||:..:..|    ..:.||..|:|..:.......|::
  Fly   361 VRTNFQKKLLMVELNWMNSDAQTEINMFLRATEMNPS----TINCGGFFDVNRTLFKGLLTTMVT 421

  Fly   359 YIVICIQFSINFRAKKMSNEQMSQNIT 385
            |:|:.:||.|:....|..:|. :.|||
  Fly   422 YLVVLLQFQISIPTDKGDSEG-ANNIT 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 83/400 (21%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 83/400 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.