DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr59f

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:376 Identity:68/376 - (18%)
Similarity:145/376 - (38%) Gaps:89/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DRFSSTIDLSNFVALVLGHAIIVLELLW-----GNCSKDVDRQLQAIHSQIKLQLGTSNSTDRVR 126
            :||...:.||   .::|.:.:.||...|     ......:||.|.||.|.|              
  Fly    60 NRFYRLVHLS---WMILWYGLFVLGSYWEFVLVTTQRVSLDRYLNAIESAI-------------- 107

  Fly   127 RYCNWIYGSLIIRW--------LIFIVVTIYSNRALTINATYSELVFLARFSEFTLY------CA 177
             |...|:..:::.|        |:..:||...|||.||:...::     ||....|:      |.
  Fly   108 -YVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTK-----RFIRLQLFLVGIFACL 166

  Fly   178 VILF--------IYQELIVGGS----NVLDELYRTRYEM------WSIRRLS------------- 211
            .|.|        :|:.::...|    |::..:...:|.:      |..|||:             
  Fly   167 AIFFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLERELTHLHSP 231

  Fly   212 -LQKLAKLQAIHNSLWQAIRCLECYFQLSLITLLMKFFIDTSALPYWLYLSRVEHTRVAVQHYVA 275
             :.::.|::..|.:|....:.:...||.|::.|.:..|::.:.:.:.:| ..:|:..:|  .:..
  Fly   232 RISEVQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNFNLVLFLVY-QGIENPSMA--DFTK 293

  Fly   276 TVECIKL---LEIVVPCYLCTRCDAMQRKF---LSMFYTVTTDRRSSQLNAALRSLNLQLSQEKY 334
            .| |:.|   :.:...|.:.....::|.:.   |::...|:..|:..|  ..:....:|:.....
  Fly   294 WV-CMLLWLAMHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQ--DTITHFIIQMRTNVR 355

  Fly   335 KFSAGGMVDINTEMLGKFFFGMISYIVICIQFSINFRAKKMSNEQMSQNIT 385
            :....|:::::.:.|.........:.:..:|:.:.:.|...|   :..|:|
  Fly   356 QHVVCGVINLDLKFLTTLLVASADFFIFLLQYDVTYEALSKS---VQGNVT 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 64/359 (18%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 64/355 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.