DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr33a

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster


Alignment Length:260 Identity:44/260 - (16%)
Similarity:92/260 - (35%) Gaps:83/260 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IIRWLIFIVVTIYSNRALTINATYSELVFLARFSEFTLYCAV-ILFIYQELIVGGSNVLD----- 195
            |:.|...::..|      .:|...||..|:.   ::.:.|.| |.::...|::..|:::.     
  Fly     4 IMNWFSMVIGLI------PLNRQQSETNFIL---DYAMMCIVPIFYVACYLLINLSHIIGLCLLD 59

  Fly   196 ---------------------------ELYRTR--YEMWSIRRLSL-------QKLAKLQAIHNS 224
                                       .|||.:  ::.:..|...:       |::|::..:..:
  Fly    60 SCNSVCKLSSHLFMHLGAFLYLTITLLSLYRRKEFFQQFDARLNDIDAVIQKCQRVAEMDKVKVT 124

  Fly   225 LWQAIRCLECYFQLSLITLLMKFFIDTSALPY---WLYLSRVEHTRVAVQHYVATVECIKLLEIV 286
               |::....|.    .|.|..|.:.|.||.|   .|||               |...:..:..:
  Fly   125 ---AVKHSVAYH----FTWLFLFCVFTFALYYDVRSLYL---------------TFGNLAFIPFM 167

  Fly   287 VPCYLCTRCDAMQRKFLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGK 351
            |..:.......:|.:|:  ::.....:|..|:|..|..:|   .:.:::.:...:.||.:|  ||
  Fly   168 VSSFPYLAGSIIQGEFI--YHVSVISQRFEQINMLLEKIN---QEARHRHAPLTVFDIESE--GK 225

  Fly   352  351
              Fly   226  225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 44/260 (17%)
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.