DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr32a

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster


Alignment Length:436 Identity:77/436 - (17%)
Similarity:146/436 - (33%) Gaps:141/436 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LMKCLGMLPFGQ-----------------NLFSKGFCYVLLFVSLGFSSYWRFSFDYEFDYDFLN 66
            ::|..|::|..:                 :.|.:|..:.|...:: :|.:...|....|.|    
  Fly    63 VLKASGLMPIYEQVSDYEVGPPTKTNEFYSFFVRGVVHALTIFNV-YSLFTPISAQLFFSY---- 122

  Fly    67 DRFSSTIDLSNFVALVLGHAIIVLELLWGNCSKDVDRQLQAIHSQIKLQLGTSNSTDRVRRYCNW 131
               ..|.:::.::.|:|  .|:...|....|:.:....|:.::..::|.       :.|||.   
  Fly   123 ---RETDNVNQWIELLL--CILTYTLTVFVCAHNTTSMLRIMNEILQLD-------EEVRRQ--- 172

  Fly   132 IYGS-------LIIRWLI--------FIVVTIYSNRALTINATYSELVFL----ARFSEFTLYCA 177
             :|:       .::::|:        .||:.||:.:......:|..|.|.    ...:.:.::.:
  Fly   173 -FGANLSQNFGFLVKFLVGITACQAYIIVLKIYAVQGEITPTSYILLAFYGIQNGLTATYIVFAS 236

  Fly   178 VIL--------FIYQEL-----------IVGGSNVLDELYRTRYEMWSIRRLSLQKLAK------ 217
            .:|        ||.|.|           ..||:       |.|.:...:.......|.:      
  Fly   237 ALLRIVYIRFHFINQLLNGYTYGQQHRRKEGGA-------RARRQRGDVNPNVNPALMEHFPEDS 294

  Fly   218 --LQAIHNSLWQAIRCLECYFQLSLITLLMKFFIDTSALPYWLYLSRVEHTRVAVQHYVATVECI 280
              :..:||.|.:..:.:.....|.|::.|...|                        |..|..|.
  Fly   295 LFIYRMHNKLLRIYKGINDCCNLILVSFLGYSF------------------------YTVTTNCY 335

  Fly   281 KLL-----------EIVVPCY--LCTRCDAMQRKFLSMFYTVTTDRRSSQLNAAL---------- 322
            .|.           .|:..|:  ||.....:.....|...|.|....:||:.|.:          
  Fly   336 NLFVQITGKGMVSPNILQWCFAWLCLHVSLLALLSRSCGLTTTEANATSQILARVYAKSKEYQNI 400

  Fly   323 --RSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQF 366
              :.|...:.|| .:|:|.|...|:...|.|.|..:.:|:||.|||
  Fly   401 IDKFLTKSIKQE-VQFTAYGFFAIDNSTLFKIFSAVTTYLVILIQF 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 77/436 (18%)
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 77/436 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.