DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr23a

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:259 Identity:53/259 - (20%)
Similarity:104/259 - (40%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 WLIFIVVTIYSNRALTINATY------SELVFLARF-------SEFTLYCAVILFIYQELIVGGS 191
            ||.|   |:.:....|:...|      .|..|..|.       |...|...:|.||.:.:.|   
  Fly   113 WLAF---TVLAMLVPTLGVEYLVCSNAPEYAFRIRIYHLKTLPSFLALQVQIISFILEVMKV--- 171

  Fly   192 NVLDELYRTRYEM----------WSIRRLSLQ-------KLAKLQAIHNSLWQAIRCLECYFQLS 239
            |:  .:.:|:.::          |..|:...|       ::..|:..:|.|......:..||..|
  Fly   172 NI--RVRQTKLQLLILARELSCRWPQRKQKPQFSDQQAHRVKDLKRRYNDLHYLFVRINGYFGGS 234

  Fly   240 LITLLMKFFIDTSALPYWLYLS-RVEHTRV-AVQHYVATVECIKLLEIVVPCYLCTRCDAMQRKF 302
            |:|:::..|....:..|||::. |....|: |:...:..:..: .|::...|:.|.:...:.|:.
  Fly   235 LLTIIIVHFAIFVSNSYWLFVDIRTRPWRIYAILLNLGFIFNV-ALQMAAACWHCQQSYNLGRQI 298

  Fly   303 LSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQF 366
            ..:...:...:.|...|..:...:||...:::..:|.....:|..:|...|..:::|:||.|||
  Fly   299 GCLISKLVKPQGSKLYNDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQF 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 53/259 (20%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 44/226 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.