DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr21a

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster


Alignment Length:377 Identity:66/377 - (17%)
Similarity:128/377 - (33%) Gaps:114/377 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YVLLFVSLGFSSY------WRF------------SFDYEFDYDFLNDRFSSTIDLSNFVALVLGH 85
            |.::|:||.|:::      ||.            ::.|:|        |.:|           |.
  Fly   148 YNVIFISLLFTNFLLPVASWRHGPQVAIFKNMWTNYQYKF--------FKTT-----------GS 193

  Fly    86 AII---VLELLWGNCSKDVDRQLQAIHSQIKLQLGTSNSTDRVRRYCNWIYGSLIIRWLIFIVVT 147
            .|:   :..|.|..|                                       :..||:.|.:.
  Fly   194 PIVFPNLYPLTWSLC---------------------------------------VFSWLLSIAIN 219

  Fly   148 I---YSNRALTINATYSELVFLARFSEFTLYCAVILFIYQELIVGGSNVLDELYRTRYEMWSIR- 208
            :   :......:..|::....:|..:   .:|: :.:|........|..|.:..:|     :|| 
  Fly   220 LSQYFLQPDFRLWYTFAYYPIIAMLN---CFCS-LWYINCNAFGTASRALSDALQT-----TIRG 275

  Fly   209 RLSLQKLAKLQAIHNSLWQAIRCL-----ECYFQLSLITLLMKFFIDTSALPYWLYLSRVEH--T 266
            ....|||.:    :..||..:..:     ..|..:..:..|:.|| .|....|......::|  |
  Fly   276 EKPAQKLTE----YRHLWVDLSHMMQQLGRAYSNMYGMYCLVIFF-TTIIATYGSISEIIDHGAT 335

  Fly   267 RVAVQHYVATVECIKLLEIVVPCYLCTRCDAMQRKFLSMFYTVTTDRRSSQLNAA----LRSLNL 327
            ...|..:|....|:.||.|:     |.......||....|.|...:...:.::||    :..|.:
  Fly   336 YKEVGLFVIVFYCMGLLYII-----CNEAHYASRKVGLDFQTKLLNINLTAVDAATQKEVEMLLV 395

  Fly   328 QLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQFSINFRAKKMSNEQ 379
            .:::.....:..|..:||.|::......|.:|:|:.:||.|. ..:::..:|
  Fly   396 AINKNPPIMNLDGYANINRELITTNISFMATYLVVLLQFKIT-EQRRIGQQQ 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 65/366 (18%)
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 65/367 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.