DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr9a

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:373 Identity:75/373 - (20%)
Similarity:136/373 - (36%) Gaps:105/373 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LFSKGFCYVLLFVSLGFSSYWRFSFDYEFDYDFLNDRFSSTIDLSNFVALVLG--------HAII 88
            |.|..|..::|...:|           |.:..|..:...:....:.|..:::|        ||.|
  Fly    30 LLSSTFLVLILIELVG-----------EIETYFTEENPDNESVPAYFAKVIMGVNMAYKMIHAWI 83

  Fly    89 VLELLWGNCSKDVDRQLQAIHSQIKLQLGTSNSTDRVRRYCNWIYGSLIIRWLI-----FIVVTI 148
            .|..|: .|     |:.:.:..::.....||           :||..||:..::     |:|::.
  Fly    84 ALSALF-EC-----RRFRYLLEELPPVKATS-----------FIYRHLILEIILFACNAFLVLSE 131

  Fly   149 YSNRAL---TINATYSELVFLARFSEFTLYCAVILF---------IYQELIVGGSNVLDELYRTR 201
            |:.|.:   .:...||.....||:.:.     ::|.         ::..:|.|.|:     |:| 
  Fly   132 YTIRGIYLENLRYAYSLQAVRARYLQM-----MVLVDRLDGKLEQLHHRVISGSSD-----YKT- 185

  Fly   202 YEMWSIRRLSLQKLAKLQAIHNSLWQAIRCLECYFQLSLITLLMKFFIDTSALPYWLYLSRVEHT 266
                  .||....|||:          .|.|...|.|||:.|      :...|..|:.:..|...
  Fly   186 ------LRLDYAHLAKV----------TRSLSHLFGLSLLLL------NVLCLGDWIIVCNVYFM 228

  Fly   267 RVAVQHYVAT---------VECIKLLEIVVPCYLCTRCDA----MQRKFLSMFYTVTTDRRSSQL 318
            ...:|...||         |.|..|::|...|....||.:    :|::...:......:|     
  Fly   229 VAYLQVLPATLFLFGQVMFVVCPTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVER----- 288

  Fly   319 NAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQF 366
             :.:....||:.|:..:....|:..:|.:.|...||.::..:||.:||
  Fly   289 -SQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 75/373 (20%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 73/371 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.