DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr10a

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:257 Identity:57/257 - (22%)
Similarity:100/257 - (38%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 NSTDRVRRYCNWIYGSLIIRWLIFIVVTIYSNRALTINATYSELVFLARFSEFTLYCAVILFIYQ 184
            |.|:.:..||.:|.||         |:..|....|.:.:...|:..|........:|..:     
  Fly   192 NYTENMADYCYFINGS---------VLKYYRQFNLQLGSLRDEMDGLRPGGMLLHHCCEL----- 242

  Fly   185 ELIVGGSNVLDELYRTRYEMWSIRRLSLQKLAKLQAIHNSLWQAIRCLECYFQLSLITLLMKFFI 249
                  |:.|:||.|...|:..::|.|. ::.:.|.|...|...|..|..::  :|..:|.|..:
  Fly   243 ------SDRLEELRRRCREIHDLQRESF-RMHQFQLIGLMLSTLINNLTNFY--TLFHMLAKQSL 298

  Fly   250 DTSALPYWLYLSRVEHTRVAVQHYVATV--ECIKL-LEIVVPCYLCTRCDAMQRKFLSMFYTVTT 311
            :..:.|  :.:..|..|...:..|:..:  |.||| ||.|.   |..|..|..|:.         
  Fly   299 EEVSYP--VVVGSVYATGFYIDTYIVALINEHIKLELEAVA---LTMRRFAEPREM--------- 349

  Fly   312 DRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQFSINFRAK 373
            |.|   |...:..|:|:|...:..... |::.::..::........||.:..:||.:..|.|
  Fly   350 DER---LTREIEHLSLELLNYQPPMLC-GLLHLDRRLVYLIAVTAFSYFITLVQFDLYLRKK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 55/252 (22%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 55/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.