DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr22e

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:390 Identity:78/390 - (20%)
Similarity:149/390 - (38%) Gaps:79/390 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LGMLPFGQN-----------LFSKGF----CYVLLFVSLGFSSYWRFSFDYEFDYDFLNDRFSST 72
            ||:.||..:           |.:.||    .::||.|:....|......:. |..:.|.::.:..
  Fly    28 LGVFPFAYDSWTRTLRRSKWLIAYGFVLNAAFILLVVTNDTESETPLRMEV-FHRNALAEQINGI 91

  Fly    73 IDLSNFVALVLGHAIIVLELLWGNCSKDVDRQLQAI----HSQIK-LQLGTSNSTDRVRRYCNWI 132
            .|:.: :::|   :|::|...|.  |.|::|.|..:    |...: ..|....|.||...|..: 
  Fly    92 HDIQS-LSMV---SIMLLRSFWK--SGDIERTLNELEDLQHRYFRNYSLEECISFDRFVLYKGF- 149

  Fly   133 YGSLIIRWLIFIVVTIYSNRALTINATYSELVFLARFSEFTLYCAVILFIYQELIVGGSNV-LDE 196
              |:::..:..:|:      .|.::..||...|:...|    .|.::|.:    ::|.|:. |..
  Fly   150 --SVVLELVSMLVL------ELGMSPNYSAQFFIGLGS----LCLMLLAV----LLGASHFHLAV 198

  Fly   197 LYRTRYEMWSIRRLSLQKLAKLQAI---------------HNSLWQAIRCLECYFQLSLITLLMK 246
            ::..|| :|.:.| .|.||....||               ::.|....:.|...:...::.:::.
  Fly   199 VFVYRY-VWIVNR-ELLKLVNKMAIGETVESERMDLLLYLYHRLLDLGQRLASIYDYQMVMVMVS 261

  Fly   247 FFIDTSALPYWLYLSRVEHTR-------VAVQHYVATVECIKLLEI---VVPCYLCTRCDAMQRK 301
            |.|......|:..:..:...:       |.||..|     |.:|:.   |..|.|..|.......
  Fly   262 FLIANVLGIYFFIIYSISLNKSLDFKILVFVQALV-----INMLDFWLNVEICELAERTGRQTST 321

  Fly   302 FLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQF 366
            .|.:|..:  :....:|..::....|..|..:.:|...|:..:|.||..:.......|::..|||
  Fly   322 ILKLFNDI--ENIDEKLERSITDFALFCSHRRLRFHHCGLFYVNYEMGFRMAITSFLYLLFLIQF 384

  Fly   367  366
              Fly   385  384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 78/390 (20%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 78/390 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.