DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98a and Gr36a

DIOPT Version :9

Sequence 1:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:284 Identity:61/284 - (21%)
Similarity:115/284 - (40%) Gaps:71/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 RWLIFI-----VVTIYSNRALTINAT----YSELVFLARFSEFTL----------YCAVILFI-- 182
            ||.|.:     ||:.:...|:::.:.    ::|.|.:|  |:|.:          :..||||:  
  Fly   126 RWAILVKFSVGVVSNFLQMAISMESLDRLGFNEFVGMA--SDFWMSAIINMAISQHYLVILFVRA 188

  Fly   183 YQELI-------VGGSNVLDELYRTRYE-MWSIRRLS--LQKLAKLQAIHNSLWQAIRCLECYFQ 237
            |..|:       :..|.:|.|:|..|.. |.....|:  :..:||||   |.|...:..|...|.
  Fly   189 YYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQ---NQLQSIVTQLNQVFG 250

  Fly   238 LSLITLLMKFFI---DTSALPYWLYLSRVEHTRVAVQ-----------HYVATVECIKLLEIVVP 288
            :..|.:...::|   .|:.:.|.|.::.:|...::|:           :|.:.:     |.:.|.
  Fly   251 IQGIMVYGGYYIFSVATTYITYSLAINGIEELHLSVRAAALVFSWFLFYYTSAI-----LNLFVM 310

  Fly   289 CYLCTRCDAMQRKFLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINT------- 346
            ..|......|:|  :....|:.|.....:|..:..|:.|||.:...|..   ::||.|       
  Fly   311 LKLFDDHKEMER--ILEERTLFTSALDVRLEQSFESIQLQLIRNPLKIE---VLDIFTITRSSSA 370

  Fly   347 EMLGKFFFGMISYIVICIQFSINF 370
            .|:|    .:|:..:..||:.:.:
  Fly   371 AMIG----SIITNSIFLIQYDMEY 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 61/282 (22%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 61/282 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.