DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and CYP4F2

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:459 Identity:124/459 - (27%)
Similarity:218/459 - (47%) Gaps:52/459 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GFYLFQKPAAFVIDLELAKQILIKNFSNFT------DKGIYYNEKDDPMSAHLFNLDGPQWRLLR 133
            ||.::..|.:.:  |.|....:|::..|.:      || .:|:..:..:...|....|.:|...|
Human    87 GFKVWMGPISPL--LSLCHPDIIRSVINASAAIAPKDK-FFYSFLEPWLGDGLLLSAGDKWSRHR 148

  Fly   134 SKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHEK----VSENS-ILDVRDLVARFTVDVIGTCAFG 193
            ..|:..|....:|    ..:.:..|.:.:||.|    .||.| .||:.:.::..|:|.:..|.|.
Human   149 RMLTPAFHFNILK----PYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFS 209

  Fly   194 IKCNSLRDEKAEFLH--FGRRALLDSRHGNLVSGLMRSY---PNLARRLGLCR-----NTAQIQE 248
            .. :..:::.:|::.  ....||:..||..::..:...|   |:..|....||     ..|.|||
Human   210 FD-SHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQE 273

  Fly   249 FYQRIVKETVT--LREKENIKRNDFMDMLIGLKNQKNMTLENGEVVKGLTMDEIVAQAFVFFIAG 311
            ..:.:..:.|.  |:.|...|..||:|:|:..|:      |:|   |.|:.::|.|:|..|...|
Human   274 RRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKD------EDG---KKLSDEDIRAEADTFMFEG 329

  Fly   312 FDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQK-FTYECIKDLKYLDQVINETLRHYTI 375
            .||::|.:.:.||.|||:|..|::.|.|:.::|:..:.| ..::.:..|.:|...:.|:||.:..
Human   330 HDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPP 394

  Fly   376 VPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYPEPNEFRPERFSPEESAKRPSVA 440
            ||.:.|...:..|:|...  ||..|...:|.....||:|:::|:|..:.|.||.||...:|..:|
Human   395 VPVISRHVTQDIVLPDGR--VIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLA 457

  Fly   441 WLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSATP--DPLTFDPHSAILLGIKGGIQLK 503
            ::||..|||||||..|...:.::.||:.:..|...|....|  .|       .::|..:||:.|:
Human   458 FIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRKP-------ELVLRAEGGLWLR 515

  Fly   504 VEAI 507
            ||.:
Human   516 VEPL 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 122/454 (27%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 121/453 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.