DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:272 Identity:54/272 - (19%)
Similarity:99/272 - (36%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YFKRRGIPYDKPHPLRGNM-EGYKKTRTVHEIHQEYYNKYRNSKAPFVGFYLFQK---------- 81
            |.|::|...:....|.|:| |..:..:..|.:.......:.....||:...:.:.          
plant    40 YLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPLDADFLPRMMPFLHHTVLKHGKKCFTWYGP 104

  Fly    82 -PAAFVIDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAH-------LFNLDGPQWRLLRSKLSS 138
             |...|:|.|..::|:.|:       .::...|   :.:|       |.|.:||:|...||.|:.
plant   105 YPNVIVMDPETLREIMSKH-------ELFPKPK---IGSHNHVFLSGLLNHEGPKWSKHRSILNP 159

  Fly   139 TFTSGKMKFMYPTVVSVAEEFMAVMHEKVSENSILDV------RDLVARFTVDVIGTCAF----- 192
            .|....:|.:.|...|..:|.:.......|....:::      .||    |.:::...:|     
plant   160 AFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTMELDSWTHCHDL----TRNMLARASFGDSYK 220

  Fly   193 -GIKCNSLRDEKAEFLHFGRRALLDSRHGNLVSGLMRSYPNLARRLGLCRNTAQIQEFYQRIVKE 256
             |||...::.|:.:......||:       .:.|.........|||   |.|.:......:.:.|
plant   221 DGIKIFEIQQEQIDLGLLAIRAV-------YIPGSKFLPTKFNRRL---RETERDMRAMFKAMIE 275

  Fly   257 TVTLREKENIKR 268
            |    ::|.|||
plant   276 T----KEEEIKR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 51/262 (19%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.