DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and CYP4F11

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:405 Identity:108/405 - (26%)
Similarity:198/405 - (48%) Gaps:49/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHEK----VSENSI-LDVRDLVARFTVD 185
            |.:|...|..|:..|....:|    ..:.:..:.:.:||:|    .||.|. ||:.:.::..|:|
Human   141 GDKWSRHRRMLTPAFHFNILK----PYMKIFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLD 201

  Fly   186 VIGTCAFGIKCNSLRDEKAEFLH--FGRRALLDSRHGNLV---SGLMRSYPNLARRLGLCRNTAQ 245
            .:..|.|..:.| .:::.:|::.  ....|.::.|:..::   ..|....|:..|....|.   .
Human   202 SLQKCVFSFESN-CQEKPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACH---L 262

  Fly   246 IQEFYQRIVKE---TVT-------LREKENIKRNDFMDMLIGLKNQKNMTLENGEVVKGLTMDEI 300
            :.:|...:::|   |:.       |:.|...|..||:|:|:..|:      |:|   |.|:.::|
Human   263 VHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFIDVLLLSKD------EDG---KELSDEDI 318

  Fly   301 VAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQ-KFTYECIKDLKYLDQ 364
            .|:|..|...|.||::|.:.:.||.|||:|..|::.|.|:.::|:..:. :..::.:..|.:|..
Human   319 RAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEIEWDDLAQLPFLTM 383

  Fly   365 VINETLRHYTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYPEPNEFRPERFS 429
            .|.|:||.:..||.:.|...:.||:|...  ||..|...:|....||::|:::|:|..:.|.||.
Human   384 CIKESLRLHPPVPVISRCCTQDFVLPDGR--VIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFD 446

  Fly   430 PEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSATP--DPLTFDPHSAI 492
            .|...:|..:|::||..|||||||..|...:.::.||:.:.:|...|....|  .|       .:
Human   447 QENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILPTHTEPRRKP-------EL 504

  Fly   493 LLGIKGGIQLKVEAI 507
            :|..:||:.|:||.:
Human   505 ILRAEGGLWLRVEPL 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 106/400 (27%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 102/390 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.