DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and Cyp4e1

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_524771.1 Gene:Cyp4e1 / 44632 FlyBaseID:FBgn0015034 Length:531 Species:Drosophila melanogaster


Alignment Length:534 Identity:128/534 - (23%)
Similarity:238/534 - (44%) Gaps:95/534 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VAVALLA----IVTY----ILHRKLTYFKRRGIPYDKPH--PLRGNMEGYKKTRTVHEIHQEYY- 63
            |..|.||    :|||    :|.||....|.:|     |.  ||.||......|.|  ||...:: 
  Fly     4 VLCAFLALPLFLVTYFELGLLRRKRMLNKFQG-----PSMLPLVGNAHQMGNTPT--EILNRFFG 61

  Fly    64 --NKY-RNSKAPFVGFY---LFQKPAAFVIDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAHLF 122
              ::| :::...::|:|   :...|.  .::..|:.|.||       .|...|:.....:...|.
  Fly    62 WWHEYGKDNFRYWIGYYSNIMVTNPK--YMEFILSSQTLI-------SKSDVYDLTHPWLGLGLL 117

  Fly   123 NLDGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHE----------KVSE-NSILDVR 176
            ...|.:|...|..::..|.           .::.::|..||:|          ||:: .:|.|.:
  Fly   118 TSTGSKWHKHRKMITPAFH-----------FNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQ 171

  Fly   177 DLVARFTVDVIGTCAFGIKCNSLRDEKAEFLH--------FGRRALLDSRHGNLVSGLMRSYPNL 233
            :.....|:|||...|.|:..|::.:..:..:.        ...||....:....:......||..
  Fly   172 EEAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEY 236

  Fly   234 ARRLGLCRNTAQIQEFYQRIVKETVTLRE---KENIKRNDFMDMLIGLKNQKNM----TLENGEV 291
            ::.|      ..:|:|...|:.:.:.:|:   :..||.::|        ::|.|    ||.:.:|
  Fly   237 SKTL------KTLQDFTNEIIAKRIEVRKSGLEVGIKADEF--------SRKKMAFLDTLLSSKV 287

  Fly   292 -VKGLTMDEIVAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQH--DQKFTY 353
             .:.||..|:..:...|...|.||::|.:|||:|.|:::|..|:|:..|...|:...  .:..|:
  Fly   288 DGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATF 352

  Fly   354 ECIKDLKYLDQVINETLRHYTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYP 418
            :.|..:|:||..|.|..|.|..||.:.|...|.:|:.|:   ::..|.::.:....:.::..::.
  Fly   353 QEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVIDGD---IVPKGTTLNLGLLMLGYNDRVFK 414

  Fly   419 EPNEFRPERFSPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSATPDP 483
            :|::|:||||..|   |.....::||..|||||||.:|..::.:..::.:|:||...|  |..:.
  Fly   415 DPHKFQPERFDRE---KPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLP--ALDEL 474

  Fly   484 LTFDPHSAILLGIK 497
            ::.|.:.:..||::
  Fly   475 VSKDGYISTTLGLQ 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 116/498 (23%)
Cyp4e1NP_524771.1 p450 34..469 CDD:278495 112/481 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.