DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and CYP705A28

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:292 Identity:67/292 - (22%)
Similarity:123/292 - (42%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 QIQEFYQRIVKETVTLREKENIKRNDFMDMLIGLKNQKNMTLENGEV-VKGLTMDEIVAQAFVF- 307
            :..|..::.:.|.....|:::.|.||.||:|:   ....|.::|..: :|.::..:......:| 
plant    59 KFDELLEKFLVEHEEKMEEDHYKANDMMDLLL---EAMEMRMQNVNLCIKRVSNTKARKPPILFR 120

  Fly   308 --------------FIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQV------LEQHDQKFT 352
                          .:||.|||:....:.:.||..||:|.:::|.|:..|      :::.|    
plant   121 YGKYSNNSLLLQELLVAGTDTSALATQWTMAELINNPTILERLREEIESVVGNTRLIQETD---- 181

  Fly   353 YECIKDLKYLDQVINETLRHYTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIY 417
               :.:|.||..|:.|.||.:.......|::.:|..:.|   |.|.....:::.:.||..||:.:
plant   182 ---LSNLPYLQSVVKEGLRLHPPASISVRMSQERCELGG---FYIPEKTLLVVNTYAIMRDPNFW 240

  Fly   418 PEPNEFRPERF-----SPEESAKRPSV-AWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTF-- 474
            .:|.||:||||     |.:|...|..| .::||..|.|.|.|.....:...|.:.::::.|.:  
plant   241 EDPEEFKPERFITSSRSEQEDEMREEVLKYIPFSAGRRGCPGSNLAYVSLGIAIGVMVQCFDWRI 305

  Fly   475 -------------------SPCSATPDPLTFD 487
                               .|...||.|.|.:
plant   306 KGEKVNMSETAGTIMLAMAQPLKCTPVPRTLN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 67/292 (23%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 67/292 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.