DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and CYP4A22

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:547 Identity:136/547 - (24%)
Similarity:229/547 - (41%) Gaps:96/547 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQLTYFLFQVAVALLAIVTYILHRKLTYFKRRGIPYDKPHPLRGNMEGYKKTRTVHEIHQEYYNK 65
            :|:|..|..:.:.:.|...| |||:......:..|....|.|.|:::.::..:.:..|.:..  |
Human    19 LQVTSLLILLLLLIKAAQLY-LHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERV--K 80

  Fly    66 YRNSKAPFVGFYLFQKPAAFVIDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAH---------- 120
            ...|..|:  :....|....:.|.:..|.||               .:.||.| |          
Human    81 TFPSACPY--WIWGGKVRVQLYDPDYMKVIL---------------GRSDPKS-HGSYKFLAPRI 127

  Fly   121 ---LFNLDGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVM---HEKVSENSILDVRDLV 179
               |..|:|..|...|..|:..|.:..:|   |.|..:|:....::   .|.:.::|.|:|...|
Human   128 GYGLLLLNGQTWFQHRRMLTPAFHNDILK---PYVGLMADSVRVMLDKWEELLGQDSPLEVFQHV 189

  Fly   180 ARFTVDVIGTCAFGIKCNSLRDEKAE-FLHFGRRALLDSRHGNLVSGLMRS-------------- 229
            :..|:|.|...||..:.:...|..:: ::    :|:.|.  .:||...||:              
Human   190 SLMTLDTIMKSAFSHQGSIQVDRNSQSYI----QAISDL--NSLVFCCMRNAFHENDTIYSLTSA 248

  Fly   230 --YPNLARRLGLCRNTAQIQEFYQRIVKETVTLREKENIKRN---DFMDMLIGLKNQKNMTLENG 289
              :.:.|.:|........||....::.||    .|.|.|||.   ||:|:|:..|      :|||
Human   249 GRWTHRACQLAHQHTDQVIQLRKAQLQKE----GELEKIKRKRHLDFLDILLLAK------MENG 303

  Fly   290 EVVKGLTMDEIVAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQKFTYE 354
            .:   |:..::.|:...|...|.||::|.:.:.||.||.:|..|::.|.|:..:|.. ....|:.
Human   304 SI---LSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGD-GASITWN 364

  Fly   355 CIKDLKYLDQVINETLRHYTIVPNVDRVAAKRFVVPGN---PKFVIEAGQSVIIPSSAIHHDPSI 416
            .:..:.|....|.|.||.|..||.:.|..:.....|..   ||     |..|::....:||:|.:
Human   365 HLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPK-----GIMVLLSIYGLHHNPKV 424

  Fly   417 YPEPNEFRPERFSPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSATP 481
            :|....|.|.||:|  .:.:.|.|:|||..|.|||||.:|...|.::..|:.:..|     ...|
Human   425 WPNLEVFDPSRFAP--GSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRF-----ELLP 482

  Fly   482 DPLTFD-PHSAILLGIKGGIQLKVEAI 507
            ||.... |.:.::|..|.||.|::..:
Human   483 DPTRIPIPMARLVLKSKNGIHLRLRRL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 127/505 (25%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 127/507 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.