DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and Cyp4a8

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_038965258.1 Gene:Cyp4a8 / 266674 RGDID:628846 Length:510 Species:Rattus norvegicus


Alignment Length:487 Identity:123/487 - (25%)
Similarity:212/487 - (43%) Gaps:91/487 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 YLFQKPAAFVIDLELAKQIL--IKNFSNFTDKGIYYNE----------------KDDPMSAH--- 120
            :.|....:|::|.|. :.||  :|||.:...:.::.:.                :.||.|.|   
  Rat    58 WFFGHKLSFLVDQEF-QDILTRVKNFPSACPQWLWGSNVRIQVYDPDYMKLILGRSDPKSHHSYR 121

  Fly   121 ---------LFNLDGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHEK----VSENSI 172
                     |..|:|..|...|..|:..|....:|    ..|.:..:.:.:|.:|    |.::|.
  Rat   122 FLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDTLK----PYVGIMADSVRIMLDKWEQIVGQDST 182

  Fly   173 LDVRDLVARFTVDVIGTCAFGIKCNSLRDEKAEF----------LHFGRRALLDSRHGNLVSGLM 227
            |::...:...|:|.|..|||..:.:...|.|.:.          |.|.|  :.:..|.|   .::
  Rat   183 LEIFQHITLMTLDTIMKCAFSQEGSVQLDRKYKSYIKAVEDLNNLSFFR--IRNIFHQN---DII 242

  Fly   228 RSYPNLARRLGLCRNTAQI-QEFYQRIVK-ETVTLREKENI------KRNDFMDMLIGLKNQKNM 284
            .|..:..|:   .|:..|: .|...:::| ....|:::|.:      :|.||:|:|:..:     
  Rat   243 YSLSSNGRK---ARSAWQLAHEHTDQVIKSRKAQLQDEEELQKVKQKRRLDFLDILLFAR----- 299

  Fly   285 TLENGEVVKGLTMDEIVAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQ 349
             :|||   ..|:..::.|:...|...|.||::|.:.:..|.||.||..|...|.|: |.|.....
  Rat   300 -IENG---SSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQGCRKEI-QSLLGDGA 359

  Fly   350 KFTYECIKDLKYLDQVINETLRHYTIVPNVDRVAAKRFVVPGN---PKFVIEAGQSVIIPSSAIH 411
            ..|::.:..:.|....|.|.||.|..|..|.|:.:.....|..   ||     |.:|::....:|
  Rat   360 SITWDDLDKMPYTTMCIKEALRIYPPVTAVSRMLSTPVTFPDGRSLPK-----GITVMLSFYGLH 419

  Fly   412 HDPSIYPEPNEFRPERFSPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSP 476
            |:|:::|.|..|.|.||:||.|  |.|.::|||..|.|||||.:|...:.::.:|:.:..|    
  Rat   420 HNPTVWPNPEVFDPYRFAPESS--RHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRF---- 478

  Fly   477 CSATPDPLTFD-PHSAILLGIKGGIQLKVEAI 507
             ...|||.... |...::|..|.||.|:::.:
  Rat   479 -ELLPDPTRIPIPIPRLVLKSKNGIYLRLKKL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 123/482 (26%)
Cyp4a8XP_038965258.1 CYP4B-like 72..505 CDD:410771 118/467 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.