DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:221 Identity:65/221 - (29%)
Similarity:110/221 - (49%) Gaps:8/221 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFQVAVALLAIVTYILHRKLTYFKRR---GIPYDKPHPLRGNMEGY--KKTRTVHEIHQEYYNKY 66
            |..:.|:|::.:.|::..:...|:.|   |:...:||.|.||::..  :|.:..::...::|||.
 Worm     6 LTSILVSLVSFIIYVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIERKAKLGYDDSYDWYNKL 70

  Fly    67 RNSKAPFVGFYLFQKPAAFVIDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAHLF-NLDGPQWR 130
            ........|.|...:....:.:.|..|::.|||||||:|:......:|:.:...|. |.....|:
 Worm    71 HKQFGETFGIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESLLQNTYESGWK 135

  Fly   131 LLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHEKVSENSILDVRDLVARFTVDVIGTCAFGIK 195
            ..||.::..|::||||.|:.|:.|..:.|:.::.||.|.....|:.|.....|:||||.|||.|.
 Worm   136 HTRSAIAPIFSTGKMKAMHETIHSKVDLFLEILKEKASSGQKWDIYDDFQGLTLDVIGKCAFAID 200

  Fly   196 CNSLRDEKAEFLHFGRRAL--LDSRH 219
            .|..||....|....|:.:  :|.||
 Worm   201 SNCQRDRNDIFYVNARKFITNIDIRH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 58/187 (31%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 54/177 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.