DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and CYP4A11

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:548 Identity:137/548 - (25%)
Similarity:232/548 - (42%) Gaps:98/548 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQLTYFLFQVAVALLAIVTYILHRKLTYFKRRGIPYDKPHPLRGNMEGYKKTRTVHEIHQEYYNK 65
            :|....|..:.:.:.|:..| |||:......:..|....|.|.|:::..::.:.:..| |::...
Human    19 LQAASLLILLLLLIKAVQLY-LHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRI-QKWVET 81

  Fly    66 YRNSKAPFVGFYLF-QKPAAFVIDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAH--------- 120
            : .|..|   .:|: .|....:.|.:..|.||               .:.||.| |         
Human    82 F-PSACP---HWLWGGKVRVQLYDPDYMKVIL---------------GRSDPKS-HGSYRFLAPW 126

  Fly   121 ----LFNLDGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVM---HEKVSENSILDVRDL 178
                |..|:|..|...|..|:..|....:|   |.|..:|:....::   .|.:.::|.|:|...
Human   127 IGYGLLLLNGQTWFQHRRMLTPAFHYDILK---PYVGLMADSVRVMLDKWEELLGQDSPLEVFQH 188

  Fly   179 VARFTVDVIGTCAFGIKCNSLRDEKAE-FLHFGRRALLDSRHGNLVSGLMRS------------- 229
            |:..|:|.|..|||..:.:...|..:: ::    :|:.|.  .|||...:|:             
Human   189 VSLMTLDTIMKCAFSHQGSIQVDRNSQSYI----QAISDL--NNLVFSRVRNAFHQNDTIYSLTS 247

  Fly   230 ---YPNLARRLGLCRNTAQIQEFYQRIVKETVTLREKENIKRN---DFMDMLIGLKNQKNMTLEN 288
               :.:.|.:|........||....::.||    .|.|.|||.   ||:|:|:..|      :||
Human   248 AGRWTHRACQLAHQHTDQVIQLRKAQLQKE----GELEKIKRKRHLDFLDILLLAK------MEN 302

  Fly   289 GEVVKGLTMDEIVAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQKFTY 353
            |.:   |:..::.|:...|...|.||::|.:.:.||.||.:|..|::.|.|:..:|.. ....|:
Human   303 GSI---LSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGD-GASITW 363

  Fly   354 ECIKDLKYLDQVINETLRHYTIVPNVDRVAAKRFVVPGN---PKFVIEAGQSVIIPSSAIHHDPS 415
            ..:..:.|....|.|.||.|..||.:.|..:.....|..   ||     |..|::....:||:|.
Human   364 NHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPK-----GIMVLLSIYGLHHNPK 423

  Fly   416 IYPEPNEFRPERFSPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSAT 480
            ::|.|..|.|.||:|  .:.:.|.|:|||..|.|||||.:|...:.::..|:.:..|     ...
Human   424 VWPNPEVFDPFRFAP--GSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRF-----ELL 481

  Fly   481 PDPLTFD-PHSAILLGIKGGIQLKVEAI 507
            |||.... |.:.::|..|.||.|::..:
Human   482 PDPTRIPIPIARLVLKSKNGIHLRLRRL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 129/506 (25%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 129/508 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.