DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a18 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:444 Identity:116/444 - (26%)
Similarity:195/444 - (43%) Gaps:81/444 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KGIYYNEKDDPMSAHLFN------------LDGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEE 158
            |.:|  .:.||.:|::::            |:||:|...|..|:..|....:|   |.|...||.
Mouse   101 KAVY--SRGDPKAAYVYDFFLQWIGKGLLVLEGPKWFQHRKLLTPGFHYDVLK---PYVAIFAES 160

  Fly   159 FMAVM---HEKVSENSILDVRDLVARFTVDVIGTCAFGIKCNSL-RDEKAEFLHFGRRALL---- 215
            ...::   .:|.|||...|:...|....:|.:..|.||...:.| ..:.:.:|......||    
Mouse   161 TRVMLDKWEKKASENKSFDIFCDVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQR 225

  Fly   216 -DS--RHGNLVSGLMRSYPNLARRLGLC------------RNTAQIQEFYQRIVKETVTLREKEN 265
             ||  .|.:.:..|.   |:..|.|..|            :..|.:|:     .||...|:|:.:
Mouse   226 IDSFQYHNDFIYWLT---PHGRRFLRACQIAHDHTDHVIRQRKAALQD-----EKEQKKLQERRH 282

  Fly   266 IKRNDFMDMLIGLKNQKNMTLENGEVVKGLTMDEIVAQAFVFFIAGFDTSSSTMGFALYELAKNP 330
            :   ||:|:|:|.:::..:.|.:.         ::.|:...|...|.||::|.:.:.||.:|..|
Mouse   283 L---DFLDILLGARDESGIKLSDA---------DLRAEVDTFMFEGHDTTTSGISWFLYCMALYP 335

  Fly   331 SIQDKVRAELGQVLEQHDQKFTYECIKDLKYLDQVINETLRHYTIVPNVDRVAAKRFV-VPGNPK 394
            ..|.:.|.|:.::|...| .|.::.:..:.||...:.|..|.|..||.|.|..:|... |.|.. 
Mouse   336 MHQQRCREEVREILGDRD-SFQWDDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRS- 398

  Fly   395 FVIEAGQSVIIPSSAIHHDPSIYPEPNEFRPERFSPEESAKRPSVAWLPFGEGPRNCIGLRFGQM 459
              :.||..:.:...|:|.:.:::|:|..|.|.|||||....|...|::||..|||||||.:|...
Mouse   399 --LPAGSLISLHIYALHRNSAVWPDPEVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMN 461

  Fly   460 QARIGLAMLIKNFTFSPCSATPDPLTFDPHS------AILLGIKGGIQLKVEAI 507
            :.::..|:.:..|.|||          ||..      .::|..|.||.|.::.:
Mouse   462 EMKVVTALCLLRFEFSP----------DPSKIPIKVPQLILRSKNGIHLYLKPL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 116/439 (26%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 115/437 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.