DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and NPP1

DIOPT Version :9

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_009955.2 Gene:NPP1 / 850391 SGDID:S000000621 Length:742 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:69/335 - (20%)
Similarity:126/335 - (37%) Gaps:83/335 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VVFVTDGLRAATFLANNGSDVPDLKDIY--RQQGRIGISRT-----CAPTMTRPGHIAIFAG--- 103
            :|...||...:.....|   .|.|.|:|  :..|.:.|:.|     ..||.|.|.|..:..|   
Yeast   171 IVISLDGFHPSLISKRN---TPFLHDLYELKYDGGMNITSTPFMVPSFPTETFPNHWTLVTGQYP 232

  Fly   104 FHEDPAASL-----MHLCYNPGDFD-TVFNRSRNMIGW--AHSYIVG--YFVKLSH--GGAPLRF 156
            .|....:::     ::..::||..| .::|.:.....|  ..|...|  .|...:|  .|:.:.:
Yeast   233 IHHGIVSNVFWDPDLNEEFHPGVLDPRIWNNNDTEPIWQTVQSAFDGDIPFKAATHMWPGSDVNY 297

  Fly   157 DSYMERDL-PE---KLTCDKWAF------------DKVENFLRNVDNVREWRNYKPAVFFVYLAD 205
            ..|.|..| ||   .:..::..|            .|:...:..||  ....|.:|.:...|:.:
Yeast   298 TKYNEEKLQPEHKNPIARERTPFYFDEFNAKEPLSQKLSKIIEYVD--MSTLNERPQLILGYVPN 360

  Fly   206 MDIAAHRFKPLSKKFFAKLQYTQR-GIRNTY--ELFERVFNDSRTAY---LMTSDHGMNNEGAHG 264
            :|...|:....|:..:....:|:. |..:|:  :|.|.:...:.|::   ::.|||||       
Yeast   361 VDAFGHKHGYPSESEYYYEDFTETLGEVDTFLKQLVESLQERNLTSFTNLVIVSDHGM------- 418

  Fly   265 SGSPLEVETPLFMWGAGVKRDEIDAEANFPEKPNISQVDQTQL-APLMSSLIGLPPPKNNLALMP 328
              |.:.|.:.:.:|     .|.:|      ||.....|....| .|:|:           ::|..
Yeast   419 --SDIVVPSNVIIW-----EDLLD------EKLRKDYVSHAYLEGPMMA-----------ISLKD 459

  Fly   329 VGYLNVSDEY 338
            .|  |:::.|
Yeast   460 SG--NINEVY 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 66/323 (20%)
PigN 414..839 CDD:282796
NPP1NP_009955.2 Phosphodiest 170..545 CDD:396300 69/335 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.