DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and zgc:153896

DIOPT Version :9

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001038659.2 Gene:zgc:153896 / 569930 ZFINID:ZDB-GENE-060825-119 Length:439 Species:Danio rerio


Alignment Length:408 Identity:71/408 - (17%)
Similarity:117/408 - (28%) Gaps:159/408 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DRLVVFVTDGLRAATFLANNGSDVPDLKDIYRQQGRIGISRTCAPTMTRPGHIAIFAG------- 103
            ::|::...||.|   :..:...|.|:|..:.::..:.......|.|||.|.|.....|       
Zfish    27 NKLLLISFDGFR---WDYDQDVDTPNLDKLVKEGVKAKYINPPALTMTSPSHFTTITGRWIEDHG 88

  Fly   104 ------FHEDPAASLMHLC-------YNPGDFDTVFNRSRNMIGWAHSYIVGYFVKLSHGGAPLR 155
                  |::.....:.|..       ::.|.........:..:..|..|..|..|..| |.|..|
Zfish    89 VVHNLMFNDTTGLRVPHKATLKKSEWWDNGVLPLWITAQKQGLKTASFYYPGGGVNYS-GQAVNR 152

  Fly   156 F--DSYMERDLPEKLTCDKWAFDKVENFLRNVDNVREWRNYKPAVFF-VYLADMDIAAHRFKPLS 217
            |  :::...|            |....:.:|:|.|..|...:...|. :|..:.|...|...|.:
Zfish   153 FLVENHGSPD------------DNETEWQQNIDTVMGWFAKEDFDFVTLYYGEPDNVGHAVGPET 205

  Fly   218 ---KKFFAKLQYTQRGIRNTYELFERVFNDSRTAYL---MTSDHGMN------------------ 258
               :|...::..|...:|      |.:..::.|.:|   :||||||.                  
Zfish   206 HERRKIIEQIDRTIGYLR------ESIHKNALTDHLNVILTSDHGMTTIKNATEVKEIVLANYIS 264

  Fly   259 ----------------------------------------------------------------- 258
                                                                             
Zfish   265 LLKLTRFDLLDYGGFGMITPREGKEQEVYNALKNAHPNLTVYRKDELPENFHMKKHARIQPIVLL 329

  Fly   259 ---------------NEGAHGSGSPLEVETPLFMWGAGVKRDEIDAEANFPEKPNISQVDQTQLA 308
                           |:|.||..|. |::..:|....|.     |...||..:|    .|...:.
Zfish   330 ADLGFNINSRLILDINKGDHGFSSE-EMDMKMFFRAFGP-----DFSPNFLAEP----FDSVSIY 384

  Fly   309 PLMSSLIGLPPPKNNLAL 326
            |||..|:|:.|..||.:|
Zfish   385 PLMCKLLGVVPEANNGSL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 71/408 (17%)
PigN 414..839 CDD:282796
zgc:153896NP_001038659.2 Enpp 27..392 CDD:293742 66/396 (17%)
Phosphodiest 29..352 CDD:279931 53/344 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.