DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and enpp5

DIOPT Version :9

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_005160520.3 Gene:enpp5 / 563498 ZFINID:ZDB-GENE-041014-10 Length:512 Species:Danio rerio


Alignment Length:357 Identity:67/357 - (18%)
Similarity:112/357 - (31%) Gaps:149/357 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 TMTRPGHIAIFAGFHEDPAASLMHLCYNPGDFDTVFNRSRNMIGWAHSYIVGYFVKLSHGGAPLR 155
            |.|.|.|..:..|.|.:....:.:..|:|     :.|||.::.|                  |..
Zfish   111 TKTYPNHYTLVTGLHAESHGVVANEMYDP-----IHNRSFSIEG------------------PEV 152

  Fly   156 FDS-YMERDLPEKLTCDK---------WAFDKV-------ENFLR---------NVDNVREWRNY 194
            :|: :.|...|..:|..|         |....|       .::||         .|..:.:|.:.
Zfish   153 YDAWWWEEAEPLWVTNQKAGRKSGAAMWPGSDVAIGGTFPTHYLRYNASMLFETRVQKLIDWFSG 217

  Fly   195 KPAVFF--VYLADMDIAAHRF---KPLSKKFFA----KLQYTQRGIRNTYELFERVFNDSRTAYL 250
            ..|:.|  :|..:.|.:.|..   .||.....|    ||.:.:..:::. .|:::|      ..:
Zfish   218 PEAINFGVLYWEEPDESGHNLGPESPLMDVVLADIDEKLGFLREKLKSA-GLYDKV------NLI 275

  Fly   251 MTSDHGMNNEGAHGSGSPLE--VETPLFMW-----GAGV------------------------KR 284
            :|||||| .:.:|.....|:  |...|:.|     ..|:                        |:
Zfish   276 VTSDHGM-TQLSHDKIIELDTYVSRDLYTWIDKSPVVGILPKEGKLEEVYGLLKNANPNMVVYKK 339

  Fly   285 DEIDAEANFPEK-----------------------------------PNISQV----------DQ 304
            :||....::...                                   ||:..|          |.
Zfish   340 EEIPDHYHYRHNARIMPLIIEVKEGWTVMQNRNGSFMLGNHGYNNSLPNMHPVFVARGPAFRRDY 404

  Fly   305 TQ-------LAPLMSSLIGLPPPKNNLALMPV 329
            |:       |.|||.|::.|.|..||.:|..|
Zfish   405 TKTSMRSVDLYPLMCSILALKPLPNNGSLSSV 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 66/354 (19%)
PigN 414..839 CDD:282796
enpp5XP_005160520.3 Enpp 71..422 CDD:293742 61/341 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.