DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and enpp1

DIOPT Version :9

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_005160498.1 Gene:enpp1 / 562399 ZFINID:ZDB-GENE-040724-172 Length:878 Species:Danio rerio


Alignment Length:322 Identity:59/322 - (18%)
Similarity:99/322 - (30%) Gaps:108/322 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVVFVTDGLRAATF------------LANNGSDVPDLKDIYRQQGRIGISRTCAPTMTRPGHIAI 100
            |::...||.||...            |...|:..|.::..|             ||.|.|.|..|
Zfish   179 LLLVSLDGFRAGYMNAYSALLPAIRKLRECGTSTPYMRPAY-------------PTKTFPNHYTI 230

  Fly   101 FAGFHEDPAASLMHLCYNPG-------DFDTVFN------------RSRNMIGWAHSYIVGYFVK 146
            ..|.:.:....:.:..|:..       ..|..||            ..:|.:..|..:..|..||
Zfish   231 VTGLYPETHGIVDNKMYDVNRNASFSLKVDEKFNPLWYQGEPVWITAMKNHLKTATFFWPGSDVK 295

  Fly   147 LSHGGAPLRFDSYMERDLPEKLTCDKW-AFDKVENFLRNVDNVREW----RNYKPAVFFVYLADM 206
            : ||..|                 |.| .:::...|.:.:..:.:|    ...:|..:.:|..:.
Zfish   296 V-HGRYP-----------------DYWIKYNRNILFEKRIAQIFQWLHLPEGERPDFYTLYFEEP 342

  Fly   207 DIAAHRFKPLSKKFFAKLQYTQRGI---------RNTYELFERVFNDSRTAYLMTSDHGMNN--- 259
            |.:.|::.|:|.:....|....|.|         ||.::....|         :.|||||..   
Zfish   343 DASGHKYGPMSTQVIEALINVDRLIGMLMDGLKERNLHKCVNVV---------LVSDHGMEEASC 398

  Fly   260 -------------------EGAHGSGSPLEVETPLFMWG-AGVKRDEIDAEANFPEKPNISQ 301
                               :|......|..|....|.:. .|:.::....|.|.|.||.:.:
Zfish   399 KKAAYVSNYLDNINDITVIQGPAARVRPRHVPEEFFSFDYEGLVKNLSCREPNQPMKPYLKE 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 59/322 (18%)
PigN 414..839 CDD:282796
enpp1XP_005160498.1 Somatomedin_B 70..108 CDD:279385
SO 112..155 CDD:197571
Enpp 177..545 CDD:293742 59/322 (18%)
Phosphodiest 179..505 CDD:279931 59/322 (18%)
NUC 644..862 CDD:294067
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.