DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and ENPP7

DIOPT Version :9

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_011523039.1 Gene:ENPP7 / 339221 HGNCID:23764 Length:464 Species:Homo sapiens


Alignment Length:422 Identity:74/422 - (17%)
Similarity:126/422 - (29%) Gaps:143/422 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DRLVVFVTDGLRAATFLANNGSDVPDLKDIYRQQGRIGI-SRTCAP---TMTRPGHIAIFAGFHE 106
            ::|::...||.|   :..:...|.|:|..:.|.    |: :|...|   |||.|.|..:..|.:.
Human   104 NKLLLVSFDGFR---WNYDQDVDTPNLDAMARD----GVKARYMTPAFVTMTSPCHFTLVTGKYI 161

  Fly   107 DPAASLMHLCYN-PGDFDTVFNRSRNMIGWAHSYIVGYFVKLSHGGAPLRFDSYMERDLP-EKLT 169
            :....:.::.|| .......::.:..:..|..:..|..::.....|  ||..|:.   .| ..:|
Human   162 ENHGVVHNMYYNTTSKVKLPYHATLGIQRWWDNGSVPIWITAQRQG--LRAGSFF---YPGGNVT 221

  Fly   170 CDKWAF--DKVENFLRNVDNVREWRNYKPAVF-----------FVYLADMDIAAHRFKPLSKKFF 221
            ....|.  .:.|....|..|..|||.....|.           .:|..:.|...||:.|.|.:..
Human   222 YQGVAVTRSRKEGIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDSTGHRYGPESPERR 286

  Fly   222 AKLQYTQRGIRNTYELFERVFNDSRTAYLMTSDHGMNNEGAHGSGSPLEVETPLFMWGAGVKRDE 286
            ..::...|.:....|...|.....|...::||||||..                           
Human   287 EMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMTT--------------------------- 324

  Fly   287 IDAEA----NFPEKPNISQVDQTQLAPLMSSLIGLPPPKNNLALMPVGYLNVSDEYQAVALHLNV 347
            :|..|    .|.:.||.:                                               
Human   325 VDKRAGDLVEFHKFPNFT----------------------------------------------- 342

  Fly   348 LQLLSQAEILIGRHEKAIFYKWLPKFKELHIGVIDQYAAQFDILKSEGNLTDAMEFCKE------ 406
                                     |:::...::| |.....:|..||.|....:..|:      
Human   343 -------------------------FRDIEFELLD-YGPNGMLLPKEGRLEKVYDALKDAHPKLH 381

  Fly   407 -YGKLA-KKCLTYYNQYYQTPLIVANSMSYMI 436
             |.|.| .:...|.|....|||::.:.:.|:|
Human   382 VYKKEAFPEAFHYANNPRVTPLLMYSDLGYVI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 56/304 (18%)
PigN 414..839 CDD:282796 7/23 (30%)
ENPP7XP_011523039.1 Enpp 104..325 CDD:293742 51/259 (20%)
Phosphodiest 106..413 CDD:279931 73/418 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.