DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and Enpp6

DIOPT Version :9

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_796278.1 Gene:Enpp6 / 320981 MGIID:2445171 Length:440 Species:Mus musculus


Alignment Length:303 Identity:54/303 - (17%)
Similarity:105/303 - (34%) Gaps:89/303 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RLVVFVTDGLRAATFLANNGSDVPDLKDIYRQQGRIGISRTCAPTMTRPGHIAIFAGFHEDPAAS 111
            :|:|.:.||.|:.....:..:.:|..::|..:..::.......|:::.|.:..:..|.|.:....
Mouse    25 KLLVLLLDGFRSDYISEDALASLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQM 89

  Fly   112 LMHLCYNP---GDFDTVFNRSRNMIGWAHSYIVGYFVKLSHGGAPLRFDSYMERDLPEKLTCDKW 173
            :.:..::|   ..||...||...|..|            .:|..||.......|   .|:....|
Mouse    90 IGNYMWDPRTNKSFDIGVNRDSLMPLW------------WNGSEPLWITLMKAR---RKVYMYYW 139

  Fly   174 AFDKVE-------------------NFLRNV-DNVREWRNYKPAVFFVYLADMDIAAHRFKPLSK 218
            ...:||                   ||...| |.:...::.:..:..:|...:|:..|.:.|.|.
Mouse   140 PGCEVEILGVRPTYCLEYKTVPTDINFANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSP 204

  Fly   219 -------------KFFAKLQYTQ-RGIRNTYELFERVFNDSRTAYLMTSDHGMNNEGAHGSGSPL 269
                         |:.  :|:.| ||::....:            ::.|||||            
Mouse   205 QRKDALRAVDTVLKYM--IQWIQDRGLQQDLNV------------ILFSDHGM------------ 243

  Fly   270 EVETPLFMWGAGVKRDEIDAEANFPEKPNISQVDQTQLAPLMS 312
               |.:| |     .|::...:|:....::.||...  .|::|
Mouse   244 ---TDIF-W-----MDKVIELSNYISLDDLQQVKDR--GPVVS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 54/303 (18%)
PigN 414..839 CDD:282796
Enpp6NP_796278.1 Phosphodiest 26..357 CDD:366747 54/302 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.